PDB entry 1tjl

View 1tjl on RCSB PDB site
Description: Crystal structure of transcription factor DksA from E. coli
Deposited on 2004-06-06, released 2004-09-07
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-07, with a file datestamp of 2004-09-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.228
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tjlA (A:)
    mqegqnrktsslsilaiagvepyqekpgeeymneaqlahfrrileawrnqlrdevdrtvt
    hmqdeaanfpdpvdraaqeeefslelrnrdrerklikkiektlkkvededfgycescgve
    igirrlearptadlcidcktlaeirekqmag
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tjlA (A:)
    rktsslsilaiagvepyqekpgeeymneaqlahfrrileawrnqlrdevdrtvthmqdea
    anfpdpvdraaqeeefslelrnrdrerklikkiektlkkvededfgycescgveigirrl
    earptadlcidcktlaeirekqmag
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tjlB (B:)
    mqegqnrktsslsilaiagvepyqekpgeeymneaqlahfrrileawrnqlrdevdrtvt
    hmqdeaanfpdpvdraaqeeefslelrnrdrerklikkiektlkkvededfgycescgve
    igirrlearptadlcidcktlaeirekqmag
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tjlB (B:)
    rktsslsilaiagvepyqekpgeeymneaqlahfrrileawrnqlrdevdrtvthmqdea
    anfpdpvdraaqeeefslelrnrdrerklikkiektlkkvededfgycescgveigirrl
    earptadlcidcktlaeirekqmag
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1tjlC (C:)
    mqegqnrktsslsilaiagvepyqekpgeeymneaqlahfrrileawrnqlrdevdrtvt
    hmqdeaanfpdpvdraaqeeefslelrnrdrerklikkiektlkkvededfgycescgve
    igirrlearptadlcidcktlaeirekqmag
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tjlC (C:)
    rktsslsilaiagvepyqekpgeeymneaqlahfrrileawrnqlrdevdrtvthmqdea
    anfpdpvdraaqeeefslelrnrdrerklikkiektlkkvededfgycescgveigirrl
    earptadlcidcktlaeirekqmag
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1tjlD (D:)
    mqegqnrktsslsilaiagvepyqekpgeeymneaqlahfrrileawrnqlrdevdrtvt
    hmqdeaanfpdpvdraaqeeefslelrnrdrerklikkiektlkkvededfgycescgve
    igirrlearptadlcidcktlaeirekqmag
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tjlD (D:)
    rktsslsilaiagvepyqekpgeeymneaqlahfrrileawrnqlrdevdrtvthmqdea
    anfpdpvdraaqeeefslelrnrdrerklikkiektlkkvededfgycescgveigirrl
    earptadlcidcktlaeirekqmag
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1tjlE (E:)
    mqegqnrktsslsilaiagvepyqekpgeeymneaqlahfrrileawrnqlrdevdrtvt
    hmqdeaanfpdpvdraaqeeefslelrnrdrerklikkiektlkkvededfgycescgve
    igirrlearptadlcidcktlaeirekqmag
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tjlE (E:)
    rktsslsilaiagvepyqekpgeeymneaqlahfrrileawrnqlrdevdrtvthmqdea
    anfpdpvdraaqeeefslelrnrdrerklikkiektlkkvededfgycescgveigirrl
    earptadlcidcktlaeirekqmag
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1tjlF (F:)
    mqegqnrktsslsilaiagvepyqekpgeeymneaqlahfrrileawrnqlrdevdrtvt
    hmqdeaanfpdpvdraaqeeefslelrnrdrerklikkiektlkkvededfgycescgve
    igirrlearptadlcidcktlaeirekqmag
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tjlF (F:)
    rktsslsilaiagvepyqekpgeeymneaqlahfrrileawrnqlrdevdrtvthmqdea
    anfpdpvdraaqeeefslelrnrdrerklikkiektlkkvededfgycescgveigirrl
    earptadlcidcktlaeirekqmag
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1tjlG (G:)
    mqegqnrktsslsilaiagvepyqekpgeeymneaqlahfrrileawrnqlrdevdrtvt
    hmqdeaanfpdpvdraaqeeefslelrnrdrerklikkiektlkkvededfgycescgve
    igirrlearptadlcidcktlaeirekqmag
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tjlG (G:)
    rktsslsilaiagvepyqekpgeeymneaqlahfrrileawrnqlrdevdrtvthmqdea
    anfpdpvdraaqeeefslelrnrdrerklikkiektlkkvededfgycescgveigirrl
    earptadlcidcktlaeirekqmag
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1tjlH (H:)
    mqegqnrktsslsilaiagvepyqekpgeeymneaqlahfrrileawrnqlrdevdrtvt
    hmqdeaanfpdpvdraaqeeefslelrnrdrerklikkiektlkkvededfgycescgve
    igirrlearptadlcidcktlaeirekqmag
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tjlH (H:)
    rktsslsilaiagvepyqekpgeeymneaqlahfrrileawrnqlrdevdrtvthmqdea
    anfpdpvdraaqeeefslelrnrdrerklikkiektlkkvededfgycescgveigirrl
    earptadlcidcktlaeirekqmag
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1tjlI (I:)
    mqegqnrktsslsilaiagvepyqekpgeeymneaqlahfrrileawrnqlrdevdrtvt
    hmqdeaanfpdpvdraaqeeefslelrnrdrerklikkiektlkkvededfgycescgve
    igirrlearptadlcidcktlaeirekqmag
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tjlI (I:)
    rktsslsilaiagvepyqekpgeeymneaqlahfrrileawrnqlrdevdrtvthmqdea
    anfpdpvdraaqeeefslelrnrdrerklikkiektlkkvededfgycescgveigirrl
    earptadlcidcktlaeirekqmag
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1tjlJ (J:)
    mqegqnrktsslsilaiagvepyqekpgeeymneaqlahfrrileawrnqlrdevdrtvt
    hmqdeaanfpdpvdraaqeeefslelrnrdrerklikkiektlkkvededfgycescgve
    igirrlearptadlcidcktlaeirekqmag
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tjlJ (J:)
    rktsslsilaiagvepyqekpgeeymneaqlahfrrileawrnqlrdevdrtvthmqdea
    anfpdpvdraaqeeefslelrnrdrerklikkiektlkkvededfgycescgveigirrl
    earptadlcidcktlaeirekqmag