PDB entry 1tjh

View 1tjh on RCSB PDB site
Description: Crystal Structure of the broadly neutralizing anti-HIV-1 antibody 2F5 in complex with a gp41 11mer epitope
Class: Viral protein/Immune system
Keywords: 2F5, antibody, gp41, HIV-1, neutralizing, membrane-proximal
Deposited on 2004-06-04, released 2004-10-05
The last revision prior to the SCOP 1.75 freeze date was dated 2004-10-05, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.2
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: anti-HIV-1 antibody 2F5 Heavy Chain
    Species: HOMO SAPIENS
    Domains in SCOP 1.75: d1tjhh1, d1tjhh2
  • Chain 'L':
    Compound: anti-HIV-1 antibody 2F5 Light Chain
    Species: HOMO SAPIENS
    Domains in SCOP 1.75: d1tjhl1, d1tjhl2
  • Chain 'P':
    Compound: envelope glycoprotein gp41
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ACE, NH2, EDO, IPA, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tjhH (H:)
    ritlkesgpplvkptqtltltcsfsgfslsdfgvgvgwirqppgkalewlaiiysdddkr
    yspslntrltitkdtsknqvvlvmtrvspvdtatyfcahrrgpttlfgvpiargpvnamd
    vwgqgitvtisststkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgalts
    gvhtfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tjhL (L:)
    alqltqspsslsasvgdrititcrasqgvtsalawyrqkpgsppqlliydasslesgvps
    rfsgsgsgteftltistlrpedfatyycqqlhfyphtfgggtrvdvrrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'P':
    No sequence available.