PDB entry 1tjg

View 1tjg on RCSB PDB site
Description: Crystal Structure of the broadly neutralizing anti-HIV-1 antibody 2F5 in complex with a gp41 7mer epitope
Class: Viral protein/Immune system
Keywords: 2F5; ANTIBODY; GP41; HIV-1; NEUTRALIZING; MEMBRANE-PROXIMAL, Viral protein/Immune system COMPLEX
Deposited on 2004-06-04, released 2004-10-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: FAB 2F5 Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1TJG (0-236)
    Domains in SCOPe 2.04: d1tjgh1, d1tjgh2
  • Chain 'L':
    Compound: FAB 2F5 Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1TJG (0-213)
    Domains in SCOPe 2.04: d1tjgl1, d1tjgl2
  • Chain 'P':
    Compound: envelope glycoprotein gp41
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EDO, IPA, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tjgH (H:)
    ritlkesgpplvkptqtltltcsfsgfslsdfgvgvgwirqppgkalewlaiiysdddkr
    yspslntrltitkdtsknqvvlvmtrvspvdtatyfcahrrgpttlfgvpiargpvnamd
    vwgqgitvtisststkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgalts
    gvhtfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tjgL (L:)
    alqltqspsslsasvgdrititcrasqgvtsalawyrqkpgsppqlliydasslesgvps
    rfsgsgsgteftltistlrpedfatyycqqlhfyphtfgggtrvdvrrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'P':
    No sequence available.