PDB entry 1tjf

View 1tjf on RCSB PDB site
Description: The crystal structure of the N-terminal domain of CAP indicates variable oligomerisation
Class: membrane protein, protein binding
Keywords: membrane protein, PROTEIN BINDING
Deposited on 2004-06-04, released 2005-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.197
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenylyl cyclase-associated protein
    Species: Dictyostelium discoideum [TaxId:44689]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tjfa_
  • Chain 'B':
    Compound: Adenylyl cyclase-associated protein
    Species: Dictyostelium discoideum [TaxId:44689]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tjfb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tjfA (A:)
    sgaagpssasvkefqnlvdqhitpfvalskklapevgnqveqlvkaidaekalintasqs
    kkpsqetllelikplnnfaaevgkirdsnrsskffnnlsaisesigflswvvveptpgph
    vaemrgsaefytnrilkefkgvnqdqvdwvsnyvnflkdlekyikqyhttgltwnpkggd
    aksatp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tjfA (A:)
    gaagpssasvkefqnlvdqhitpfvalskklapevgnqveqlvkaidaekalintasqsk
    kpsqetllelikplnnfaaevgkirdsnrsskffnnlsaisesigflswvvveptpgphv
    aemrgsaefytnrilkefkgvnqdqvdwvsnyvnflkdlekyikqyhttgltwnpkggda
    ksatp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tjfB (B:)
    sgaagpssasvkefqnlvdqhitpfvalskklapevgnqveqlvkaidaekalintasqs
    kkpsqetllelikplnnfaaevgkirdsnrsskffnnlsaisesigflswvvveptpgph
    vaemrgsaefytnrilkefkgvnqdqvdwvsnyvnflkdlekyikqyhttgltwnpkggd
    aksatp