PDB entry 1tje

View 1tje on RCSB PDB site
Description: Crystal structure of the editing domain of threonyl-tRNA synthetase
Class: ligase
Keywords: ligase
Deposited on 2004-06-04, released 2004-11-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.202
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: threonyl-tRNA synthetase
    Species: Escherichia coli [TaxId:562]
    Gene: THRS, B1719, C2116, SF1512, S1630
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1tjea1, d1tjea2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tjeA (A:)
    mpvitlpdgsqrhydhavspmdvaldigpglakaciagrvngelvdacdliendaqlsii
    takdeegleiirhscahllghaikqlwphtkmaigpvidngfyydvdldrtltqedveal
    ekrmhelaeknydvikkkvswhearetfanrgesykvsildeniahddkpglyfheeyvd
    mcrgphvpnmrfchhfklmktagaywrgdsnnkmlqriygtawa