PDB entry 1tjc

View 1tjc on RCSB PDB site
Description: Crystal structure of peptide-substrate-binding domain of human type I collagen prolyl 4-hydroxylase
Class: hydrolase
Keywords: TPR, helical bundle, HYDROLASE
Deposited on 2004-06-04, released 2004-10-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.226
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prolyl 4-hydroxylase alpha-1 subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: P4HA1, P4HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13674 (1-End)
      • initiating methionine (0)
      • engineered (7)
    Domains in SCOPe 2.06: d1tjca_
  • Chain 'B':
    Compound: Prolyl 4-hydroxylase alpha-1 subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: P4HA1, P4HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13674 (1-End)
      • initiating methionine (0)
      • engineered (7)
    Domains in SCOPe 2.06: d1tjcb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tjcA (A:)
    mfltaedsfelgkvayteadyyhtelwmeqalrqldegeistidkvsvldylsyavyqqg
    dldkallltkklleldpehqrangnlkyfeyimakekdvnkshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tjcA (A:)
    mfltaedsfelgkvayteadyyhtelwmeqalrqldegeistidkvsvldylsyavyqqg
    dldkallltkklleldpehqrangnlkyfeyimak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tjcB (B:)
    mfltaedsfelgkvayteadyyhtelwmeqalrqldegeistidkvsvldylsyavyqqg
    dldkallltkklleldpehqrangnlkyfeyimakekdvnkshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tjcB (B:)
    mfltaedsfelgkvayteadyyhtelwmeqalrqldegeistidkvsvldylsyavyqqg
    dldkallltkklleldpehqrangnlkyfeyimak