PDB entry 1tj9

View 1tj9 on RCSB PDB site
Description: Structure of the complexed formed between group II phospholipase A2 and a rationally designed tetra peptide,Val-Ala-Arg-Ser at 1.1A resolution
Class: hydrolase
Keywords: phospholipase,complex,vars,crystal structure,1.1 resolution, hydrolase
Deposited on 2004-06-03, released 2004-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-01, with a file datestamp of 2017-01-26.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Daboia russellii russellii [TaxId:31159]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tj9a_
  • Chain 'B':
    Compound: VARS peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1TJ9 (0-3)
  • Heterogens: SO4, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tj9A (A:)
    sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
    sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
    c
    

  • Chain 'B':
    No sequence available.