PDB entry 1tj9

View 1tj9 on RCSB PDB site
Description: Structure of the complexed formed between group II phospholipase A2 and a rationally designed tetra peptide,Val-Ala-Arg-Ser at 1.1A resolution
Class: hydrolase
Keywords: phospholipase,complex,vars,crystal structure,1.1 resolution
Deposited on 2004-06-03, released 2004-06-08
The last revision prior to the SCOP 1.73 freeze date was dated 2004-06-08, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.187
AEROSPACI score: 0.84 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase a2
  Species: Daboia russelli russelli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P59071 (0-120)
  Domains in SCOP 1.73: d1tj9a_
• Chain 'B':
  Compound: VARS peptide
  Species: synthetic, synthetic
  
• Heterogens: SO4, ACY, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tj9A (A:)
  sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
  sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
  c
  

  
  
• Chain 'B':
  No sequence available.