PDB entry 1tj7

View 1tj7 on RCSB PDB site
Description: Structure determination and refinement at 2.44 A resolution of Argininosuccinate lyase from E. coli
Class: lyase
Keywords: Argininosuccinate lyase, crystallin, E. coli, Fumarase, Aspartase, LYASE
Deposited on 2004-06-03, released 2004-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.44 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Argininosuccinate Lyase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tj7a_
  • Chain 'B':
    Compound: Argininosuccinate Lyase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tj7b_
  • Heterogens: PO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tj7A (A:)
    malwggrftqaadqrfkqfndslrfdyrlaeqdivgsvawskalvtvgvltaeeqaqlee
    alnvlledvrarpqqilesdaedihswvegklidkvgqlgkklhtgrsrndqvatdlklw
    ckdtvselltanrqlqsalvetaqnnqdavmpgythlqraqpvtfahwclayvemlarde
    srlqdalkrldvsplgcgalagtayeidreqlagwlgfasatrnsldsvsdrdhvlells
    aaaigmvhlsrfaedliffntgeagfvelsdrvtsgsslmpqkknpdalelirgkcgrvq
    galtgmmmtlkglplaynkdmqedkeglfdaldtwldclhmaalvldgiqvkrprcqeaa
    qqgyanateladylvakgvpfreahhivgeavveairqgkpledlplselqkfsqvided
    vypilslqscldkraakggvspqqvaqaiafaqarlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tj7A (A:)
    lwggrftqaadqrfkqfndslrfdyrlaeqdivgsvawskalvtvgvltaeeqaqleeal
    nvlledvrarpqqilesdaedihswvegklidkvgqlgkklhtgrsrndqvatdlklwck
    dtvselltanrqlqsalvetaqnnqdavmpgythlqraqpvtfahwclayvemlardesr
    lqdalkrldvsplgcgalagtayeidreqlagwlgfasatrnsldsvsdrdhvlellsaa
    aigmvhlsrfaedliffntgeagfvelsdrvtsgsslmpqkknpdalelirgkcgrvqga
    ltgmmmtlkglplaynkdmqedkeglfdaldtwldclhmaalvldgiqvkrprcqeaaqq
    gyanateladylvakgvpfreahhivgeavveairqgkpledlplselqkfsqvidedvy
    pilslqscldkraakggvspqqvaqaiafaqarlg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tj7B (B:)
    malwggrftqaadqrfkqfndslrfdyrlaeqdivgsvawskalvtvgvltaeeqaqlee
    alnvlledvrarpqqilesdaedihswvegklidkvgqlgkklhtgrsrndqvatdlklw
    ckdtvselltanrqlqsalvetaqnnqdavmpgythlqraqpvtfahwclayvemlarde
    srlqdalkrldvsplgcgalagtayeidreqlagwlgfasatrnsldsvsdrdhvlells
    aaaigmvhlsrfaedliffntgeagfvelsdrvtsgsslmpqkknpdalelirgkcgrvq
    galtgmmmtlkglplaynkdmqedkeglfdaldtwldclhmaalvldgiqvkrprcqeaa
    qqgyanateladylvakgvpfreahhivgeavveairqgkpledlplselqkfsqvided
    vypilslqscldkraakggvspqqvaqaiafaqarlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tj7B (B:)
    rftqaadqrfkqfndslrfdyrlaeqdivgsvawskalvtvgvltaeeqaqleealnvll
    edvrarpqqilesdaedihswvegklidkvgqlgkklhtgrsrndqvatdlklwckdtvs
    elltanrqlqsalvetaqnnqdavmpgythlqraqpvtfahwclayvemlardesrlqda
    lkrldvsplgcgalagtayeidreqlagwlgfasatrnsldsvsdrdhvlellsaaaigm
    vhlsrfaedliffntgeagfvelsdrvtsgsslmpqkknpdalelirgkcgrvqgaltgm
    mmtlkglplaynkdmqedkeglfdaldtwldclhmaalvldgiqvkrprcqeaaqqgyan
    ateladylvakgvpfreahhivgeavveairqgkpledlplselqkfsqvidedvypils
    lqscldkraakggvspqqvaqaiafaqarlg