PDB entry 1tj6

View 1tj6 on RCSB PDB site
Description: Crystal structure of the Xenopus tropicalis Spred1 EVH-1 domain
Class: signaling protein
Keywords: EVH-1, Spred, SIGNALING PROTEIN
Deposited on 2004-06-03, released 2005-08-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.154
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Spred1
    Species: Xenopus tropicalis [TaxId:8364]
    Gene: Spred1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tj6a1
  • Chain 'B':
    Compound: Spred1
    Species: Xenopus tropicalis [TaxId:8364]
    Gene: Spred1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tj6b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tj6A (A:)
    gsddsyarvravvmtrddssggwlqlgggglssvtvsktlqpgdsggteflvhgerlrdk
    tvilecvlrrdlvynkvtptfhhwrigdkkfgltfqspadarafdrgirraiedlsqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tj6A (A:)
    dsyarvravvmtrddssggwlqlgggglssvtvsktlqpgdsggteflvhgerlrdktvi
    lecvlrrdlvynkvtptfhhwrigdkkfgltfqspadarafdrgirraiedlsqg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tj6B (B:)
    gsddsyarvravvmtrddssggwlqlgggglssvtvsktlqpgdsggteflvhgerlrdk
    tvilecvlrrdlvynkvtptfhhwrigdkkfgltfqspadarafdrgirraiedlsqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tj6B (B:)
    dsyarvravvmtrddssggwlqlgggglssvtvsktleflvhgerlrdktvilecvlrrd
    lvynkvtptfhhwrigdkkfgltfqspadarafdrgirraiedlsqg