PDB entry 1tj3

View 1tj3 on RCSB PDB site
Description: X-Ray structure of the Sucrose-Phosphatase (SPP) from Synechocystis sp. PCC6803 in a closed conformation
Class: hydrolase
Keywords: phosphoydrolase, HAD superfamily, sucrose, cyanobacteria, hydrolase
Deposited on 2004-06-03, released 2005-06-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.176
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sucrose-Phosphatase
    Species: Synechocystis sp. PCC 6803 [TaxId:1148]
    Gene: spp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1tj3a_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tj3A (A:)
    mrqlllisdldntwvgdqqalehlqeylgdrrgnfylayatgrsyhsarelqkqvglmep
    dywltavgseiyhpegldqhwadylsehwqrdilqaiadgfealkpqspleqnpwkisyh
    ldpqacptvidqltemlketgipvqvifssgkdvdllpqrsnkgnatqylqqhlamepsq
    tlvcgdsgndiglfetsargvivrnaqpellhwydqwgdsrhyraqsshagaileaiahf
    dfls