PDB entry 1tiz

View 1tiz on RCSB PDB site
Description: Solution Structure of a Calmodulin-Like Calcium-Binding Domain from Arabidopsis thaliana
Class: Calcium-Binding Protein
Keywords: helix-turn-helix, Structural Genomics, PSI, Protein Structure Initiative, Center for Eukaryotic Structural Genomics, CESG, Calcium-Binding Protein
Deposited on 2004-06-02, released 2004-08-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: calmodulin-related protein, putative
  Species: Arabidopsis thaliana [TaxId:3702]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9SRP5 (1-66)
    • cloning artifact (0)
  Domains in SCOPe 2.08: d1tiza1, d1tiza2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tizA (A:)
  ssakrvfekfdknkdgklsldefrevalafspyftqedivkffeeidvdgngelnadeft
  sciekml