PDB entry 1tiy

View 1tiy on RCSB PDB site
Description: x-ray structure of guanine deaminase from bacillus subtilis northeast structural genomics consortium target sr160
Class: hydrolase
Keywords: protein-Zn complex, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, HYDROLASE
Deposited on 2004-06-02, released 2004-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.222
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: guanine deaminase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: GUAD, GDE, BSU13170
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34598 (0-155)
      • modified residue (0)
      • modified residue (84)
      • expression tag (156)
    Domains in SCOPe 2.07: d1tiya1, d1tiya2
  • Chain 'B':
    Compound: guanine deaminase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: GUAD, GDE, BSU13170
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34598 (0-End)
      • modified residue (0)
      • modified residue (84)
    Domains in SCOPe 2.07: d1tiyb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tiyA (A:)
    mnhetflkravtlacegvnagiggpfgavivkdgaiiaegqnnvttsndptahaevtair
    kackvlgayqlddcilytscepcpmclgaiywarpkavfyaaehtdaaeagfddsfiyke
    idkpaeertipfyqvtltehlspfqawrnfankkeylehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tiyA (A:)
    mnhetflkravtlacegvnagiggpfgavivkdgaiiaegqnnvttsndptahaevtair
    kackvlgayqlddcilytscepcpmclgaiywarpkavfyaaehtdaaeagfddsfiyke
    idkpaeertipfyqvtltehlspfqawrnfankkeyl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tiyB (B:)
    mnhetflkravtlacegvnagiggpfgavivkdgaiiaegqnnvttsndptahaevtair
    kackvlgayqlddcilytscepcpmclgaiywarpkavfyaaehtdaaeagfddsfiyke
    idkpaeertipfyqvtltehlspfqawrnfankkeylehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tiyB (B:)
    mnhetflkravtlacegvnagiggpfgavivkdgaiiaegqnnvttsndptahaevtair
    kackvlgayqlddcilytscepcpmclgaiywarpkavfyaaehtdaaeagfddsfiyke
    idkpaeertipfyqvtltehlspfqawrnf