PDB entry 1tiw

View 1tiw on RCSB PDB site
Description: Crystal structure of E. coli PutA proline dehydrogenase domain (residues 86-669) complexed with L-Tetrahydro-2-furoic acid
Class: oxidoreductase
Keywords: beta/alpha barrel, flavoenzyme, FAD, proline catabolism
Deposited on 2004-06-02, released 2004-10-26
The last revision prior to the SCOP 1.73 freeze date was dated 2004-10-26, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional putA protein
    Species: Escherichia coli
    Gene: PUTA, POAA, B1014
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1tiwa1, d1tiwa2
  • Heterogens: FAD, TFB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tiwA (A:)
    lpqsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgra
    gmvqgllqefslssqegvalmclaeallripdkatrdalirdkisngnwqshigrspslf
    vnaatwgllftgklvsthneaslsrslnriigksgeplirkgvdmamrlmgeqfvtgeti
    aealanarkleekgfrysydmlgeaaltaadaqaymvsyqqaihaigkasngrgiyegpg
    isiklsalhprysraqydrvmeelyprlksltllarqydiginidaeesdrleisldlle
    klcfepelagwngigfviqayqkrcplvidylidlatrsrrrlmirlvkgaywdseikra
    qmdglegypvytrkvytdvsylacakkllavpnliypqfathnahtlaaiyqlagqnyyp
    gqyefqclhgmgeplyeqvtgkvadgklnrpcriyapvgthetllaylvrrllengants
    fvnriadtslpldelvadpvtaveklaqqegqtglphpkiplprdlyghgrdnsagldla
    nehrlaslssallnsalqkwqalpmleqpvaagemspvinpaepsssvdklaaalehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tiwA (A:)
    pqsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgrag
    mgvalmclaeallripdkatrdalirdsgeplirkgvdmamrlmgeqfvtgetiaealan
    arkleekgfrysydmlgeaaltaadaqaymvsyqqaihaigkasngrgiyegpgisikls
    alhprysraqydrvmeelyprlksltllarqydiginidaeesdrleisldlleklcfep
    elagwngigfviqayqkrcplvidylidlatrsrrrlmirlvkgaywdseikraqmdgle
    gypvytrkvytdvsylacakkllavpnliypqfathnahtlaaiyqlagqnyypgqyefq
    clhgmgeplyeqvtgkvadgklnrpcriyapvgthetllaylvrrllengantsfvnria
    dtslpldelvadpvtaveklaqqegqtglphpkiplprd