PDB entry 1tiu

View 1tiu on RCSB PDB site
Description: titin, ig repeat 27, nmr, 24 structures
Class: immunoglobulin-like domain
Keywords: muscle protein, immunoglobulin-like domain
Deposited on 1996-02-02, released 1996-07-11
The last revision prior to the SCOP 1.73 freeze date was dated 1996-07-11, with a file datestamp of 2007-06-04.
Experiment type: NMR24
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: titin, i27
    Species: HOMO SAPIENS
    Gene: TITIN GENE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1tiua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tiuA (A:)
    mhhhhhhsslievekplygvevfvgetahfeielsepdvhgqwklkgqpltaspdceiie
    dgkkhililhncqlgmtgevsfqaanaksaanlkvkel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tiuA (A:)
    lievekplygvevfvgetahfeielsepdvhgqwklkgqpltaspdceiiedgkkhilil
    hncqlgmtgevsfqaanaksaanlkvkel