PDB entry 1tis

View 1tis on RCSB PDB site
Description: crystal structure of thymidylate synthase from t4 phage
Class: transferase(methyltransferase)
Keywords: transferase(methyltransferase)
Deposited on 1994-01-24, released 1994-04-30
The last revision prior to the SCOP 1.73 freeze date was dated 1994-04-30, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 3.1 Å
R-factor: 0.199
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thymidylate synthase
    Species: Bacteriophage T4
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1tisa_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tisA (A:)
    mkqyqdlikdifengyetddrtgtgtialfgsklrwdltkgfpavttkklawkaciaeli
    wflsgstnvndlrliqhdsliqgktvwdenyenqakdlgyhsgelgpiygkqwrdfggvd
    qiievidrikklpndrrqivsawnpaelkymalppchmfyqfnvrngyldlqwyqrsvdv
    flglpfniasyatlvhivakmcnlipgdlifsggnthiymnhveqckeilrrepkelcel
    visglpykfrylstkeqlkyvlklrpkdfvlnnyvshppikgkmav