PDB entry 1tiq

View 1tiq on RCSB PDB site
Description: Crystal Structure of an Acetyltransferase (PaiA) in complex with CoA and DTT from Bacillus subtilis, Northeast Structural Genomics Target SR64.
Class: structural genomics, transcription
Keywords: alpha-beta protein, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, TRANSCRIPTION
Deposited on 2004-06-02, released 2004-07-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease synthase and sporulation negative regulatory protein PAI 1
    Species: Bacillus subtilis [TaxId:1423]
    Gene: PAIA, BSU32150
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21340 (1-171)
      • modified residue (4)
      • modified residue (36)
      • modified residue (56)
      • modified residue (85)
      • modified residue (144)
      • modified residue (156)
      • modified residue (166)
      • cloning artifact (172-173)
    Domains in SCOPe 2.08: d1tiqa1, d1tiqa2
  • Chain 'B':
    Compound: Protease synthase and sporulation negative regulatory protein PAI 1
    Species: Bacillus subtilis [TaxId:1423]
    Gene: PAIA, BSU32150
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21340 (1-171)
      • modified residue (4)
      • modified residue (36)
      • modified residue (56)
      • modified residue (85)
      • modified residue (144)
      • modified residue (156)
      • modified residue (166)
      • cloning artifact (172-176)
    Domains in SCOPe 2.08: d1tiqb1, d1tiqb2
  • Heterogens: COA, DTT, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tiqA (A:)
    msvkmkkcsredlqtlqqlsietfndtfkeqnspenmkaylesafnteqlekelsnmssq
    fffiyfdheiagyvkvniddaqseemgaesleieriyiknsfqkhglgkhllnkaieial
    ernkkniwlgvweknenaiafykkmgfvqtgahsfymgdeeqtdlimaktlilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tiqA (A:)
    svkmkkcsredlqtlqqlsietfndtfkeqnspenmkaylesafnteqlekelsnmssqf
    ffiyfdheiagyvkvniddaqseemgaesleieriyiknsfqkhglgkhllnkaieiale
    rnkkniwlgvweknenaiafykkmgfvqtgahsfymgdeeqtdlimaktlile
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tiqB (B:)
    msvkmkkcsredlqtlqqlsietfndtfkeqnspenmkaylesafnteqlekelsnmssq
    fffiyfdheiagyvkvniddaqseemgaesleieriyiknsfqkhglgkhllnkaieial
    ernkkniwlgvweknenaiafykkmgfvqtgahsfymgdeeqtdlimaktlilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tiqB (B:)
    svkmkkcsredlqtlqqlsietfndenmkaylesafnteqlekelsnmssqfffiyfdhe
    iagyvkvniddaqseemgaesleieriyiknsfqkhglgkhllnkaieialernkkniwl
    gvweknenaiafykkmgfvqtgahsfymgdeeqtdlimaktlilehhh