PDB entry 1tip

View 1tip on RCSB PDB site
Description: the bisphosphatase domain of the bifunctional rat liver 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase
Class: hydrolase
Keywords: multifunctional enzyme, transferase, kinase, ATP-binding, phosphorylation, alternative splicing, multigene family, hydrolase
Deposited on 1997-05-28, released 1998-01-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoenzyme intermediate of fru-2,6-bisphosphatase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: A CODING REGION WHICH COVERS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07953 (1-190)
      • modified residue (8)
    Domains in SCOPe 2.08: d1tipa_
  • Chain 'B':
    Compound: phosphoenzyme intermediate of fru-2,6-bisphosphatase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: A CODING REGION WHICH COVERS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07953 (1-190)
      • modified residue (8)
    Domains in SCOPe 2.08: d1tipb_
  • Heterogens: F6P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tipA (A:)
    mrsiylcrhgeselnlrgriggdsglsargkqyayalanfirsqgisslkvwtshmkrti
    qtaealgvpyeqwkalneidagvceemtyeeiqehypeefalrdqdkyryrypkgesyed
    lvqrlepvimelerqenvlvichqavmrcllayfldkssdelpylkcplhtvlkltpvay
    gcrvesiylnv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tipB (B:)
    mrsiylcrhgeselnlrgriggdsglsargkqyayalanfirsqgisslkvwtshmkrti
    qtaealgvpyeqwkalneidagvceemtyeeiqehypeefalrdqdkyryrypkgesyed
    lvqrlepvimelerqenvlvichqavmrcllayfldkssdelpylkcplhtvlkltpvay
    gcrvesiylnv