PDB entry 1tio

View 1tio on RCSB PDB site
Description: high packing density form of bovine beta-trypsin in cyclohexane
Deposited on 1998-09-17, released 1998-09-23
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.185
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1tioa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tioA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn