PDB entry 1tim

View 1tim on RCSB PDB site
Description: structure of triose phosphate isomerase from chicken muscle
Class: isomerase(intramolecular oxidoreductse)
Keywords: isomerase, isomerase(intramolecular oxidoreductse)
Deposited on 1976-09-01, released 1976-08-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Gallus gallus [TaxId:9031]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00940 (0-246)
      • conflict (15-16)
      • conflict (27)
      • conflict (143-144)
      • conflict (192)
      • insertion (200)
    Domains in SCOPe 2.01: d1tima_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Gallus gallus [TaxId:9031]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00940 (0-246)
      • conflict (15-16)
      • conflict (27)
      • conflict (143-144)
      • conflict (192)
      • insertion (200)
    Domains in SCOPe 2.01: d1timb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1timA (A:)
    aprkffvggnwkmngkrkslgelihtldgaklsadtevvcgapsiyldfarqkldakigv
    aaqncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaegl
    gviacigekldereagitekvvfqetkaiadnvkdwskvvlayepvwaigtgktatpqqa
    qevheklrgwlkthvsdavavqsriiyggsvtggnckelasqhdvdgflvggaslkpefv
    diinakh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1timB (B:)
    aprkffvggnwkmngkrkslgelihtldgaklsadtevvcgapsiyldfarqkldakigv
    aaqncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaegl
    gviacigekldereagitekvvfqetkaiadnvkdwskvvlayepvwaigtgktatpqqa
    qevheklrgwlkthvsdavavqsriiyggsvtggnckelasqhdvdgflvggaslkpefv
    diinakh