PDB entry 1til

View 1til on RCSB PDB site
Description: Crystal Structures of the ADP and ATP bound forms of the Bacillus Anti-sigma factor SpoIIAB in complex with the Anti-anti-sigma SpoIIAA:Poised for phosphorylation complex with ATP, crystal form II
Class: transcription
Keywords: SpoIIAB, SpoIIA, anti-sigma, anti-anti-sigma, sporulation, serine kinaseA, TRANSCRIPTION
Deposited on 2004-06-02, released 2004-06-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.234
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anti-sigma F factor
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: SpoIIAB
    Database cross-references and differences (RAF-indexed):
    • Uniprot O32727 (0-End)
      • see remark 999 (33)
      • see remark 999 (136-140)
    Domains in SCOPe 2.08: d1tila_
  • Chain 'B':
    Compound: anti-sigma f factor antagonist
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: SPOIIAA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O32726 (3-118)
      • cloning artifact (2)
      • see remark 999 (15)
      • see remark 999 (31-39)
      • see remark 999 (42)
      • engineered (60)
    Domains in SCOPe 2.08: d1tilb1, d1tilb2
  • Chain 'C':
    Compound: Anti-sigma F factor
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: SpoIIAB
    Database cross-references and differences (RAF-indexed):
    • Uniprot O32727 (0-End)
      • see remark 999 (33)
      • see remark 999 (136-140)
    Domains in SCOPe 2.08: d1tilc_
  • Chain 'D':
    Compound: anti-sigma f factor antagonist
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: SPOIIAA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O32726 (3-118)
      • cloning artifact (1-2)
      • see remark 999 (15)
      • see remark 999 (31-39)
      • see remark 999 (42)
      • engineered (60)
    Domains in SCOPe 2.08: d1tild1, d1tild2
  • Chain 'E':
    Compound: Anti-sigma F factor
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: SpoIIAB
    Database cross-references and differences (RAF-indexed):
    • Uniprot O32727 (0-End)
      • see remark 999 (33)
      • see remark 999 (136-139)
    Domains in SCOPe 2.08: d1tile_
  • Chain 'F':
    Compound: anti-sigma f factor antagonist
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: SPOIIAA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O32726 (3-118)
      • cloning artifact (2)
      • see remark 999 (15)
      • see remark 999 (31-39)
      • see remark 999 (42)
      • engineered (60)
    Domains in SCOPe 2.08: d1tilf1, d1tilf2
  • Heterogens: MG, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tilA (A:)
    mrnemhlqfsarsenesfarvtvaafvaqldptmdelteiktvvseavtnaiihgynndp
    ngivsisviiedgvvhltvrdegvgipdieearqplfttkpelersgmgftimenfmdev
    ivesevnkgttvylkkhivkskalsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tilA (A:)
    mrnemhlqfsarsenesfarvtvaafvaqldptmdelteiktvvseavtnaiihgynndp
    ngivsisviiedgvvhltvrdegvgipdieearqplfttkpelersgmgftimenfmdev
    ivesevnkgttvylkkhivks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tilB (B:)
    gshmslaidlevkqdvlivrlsgeldhhtaeelreqvtdvlenrairhivlnlgqltfmd
    asglgvilgrykqiknvggqmvvcavspavkrlfdmsglfkiirveadeqfalqalgva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tilB (B:)
    hmslaidlevkqdvlivrlsgeldhhtaeelreqvtdvlenrairhivlnlgqltfmdas
    glgvilgrykqiknvggqmvvcavspavkrlfdmsglfkiirveadeqfalqalgva
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1tilC (C:)
    mrnemhlqfsarsenesfarvtvaafvaqldptmdelteiktvvseavtnaiihgynndp
    ngivsisviiedgvvhltvrdegvgipdieearqplfttkpelersgmgftimenfmdev
    ivesevnkgttvylkkhivkskalsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tilC (C:)
    mrnemhlqfsarsenesfarvtvaafvaqldptmdelteiktvvseavtnaiihgynndp
    ngivsisviiedgvvhltvrdegvgipdieearqplfttkpelersgmgftimenfmdev
    ivesevnkgttvylkkhivks
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1tilD (D:)
    gshmslaidlevkqdvlivrlsgeldhhtaeelreqvtdvlenrairhivlnlgqltfmd
    asglgvilgrykqiknvggqmvvcavspavkrlfdmsglfkiirveadeqfalqalgva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tilD (D:)
    shmslaidlevkqdvlivrlsgeldhhtaeelreqvtdvlenrairhivlnlgqltfmda
    sglgvilgrykqiknvggqmvvcavspavkrlfdmsglfkiirveadeqfalqalgva
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1tilE (E:)
    mrnemhlqfsarsenesfarvtvaafvaqldptmdelteiktvvseavtnaiihgynndp
    ngivsisviiedgvvhltvrdegvgipdieearqplfttkpelersgmgftimenfmdev
    ivesevnkgttvylkkhivkskalsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tilE (E:)
    mrnemhlqfsarsenesfarvtvaafvaqldptmdelteiktvvseavtnaiihgynndp
    ngivsisviiedgvvhltvrdegvgipdieearqplfttkpelersgmgftimenfmdev
    ivesevnkgttvylkkhivk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1tilF (F:)
    gshmslaidlevkqdvlivrlsgeldhhtaeelreqvtdvlenrairhivlnlgqltfmd
    asglgvilgrykqiknvggqmvvcavspavkrlfdmsglfkiirveadeqfalqalgva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tilF (F:)
    hmslaidlevkqdvlivrlsgeldhhtaeelreqvtdvlenrairhivlnlgqltfmdas
    glgvilgrykqiknvggqmvvcavspavkrlfdmsglfkiirveadeqfalqalgva