PDB entry 1tik

View 1tik on RCSB PDB site
Description: crystal structure of acyl carrier protein phosphodiesterase
Class: hydrolase
Keywords: acpD, hydrolase, structural genomics, NYSGXRC, T1480, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics
Deposited on 2004-06-02, released 2004-06-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.186
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl carrier protein phosphodiesterase
    Species: Escherichia coli [TaxId:562]
    Gene: ACPD, B1412
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41407 (3-202)
      • cloning artifact (1-2)
      • modified residue (97)
      • modified residue (184)
      • expression tag (203)
    Domains in SCOPe 2.06: d1tika1, d1tika2, d1tika3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tikA (A:)
    mslskvlvlkssilagysqsnqlsdyfveqwrekhsadeitvrdlaanpipvldgelvga
    lrpsdapltprqqealalsdeliaelkahdviviaapmynfnistqlknyfdlvaragvt
    frytengpeglvtgkkaivitsrggihkdgptdlvtpylstflgfigitdvkfvfaegia
    ygpemaakaqsdakaaidsivsaeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tikA (A:)
    slskvlvlkssilagysqsnqlsdyfveqwrekhsadeitvrdlaanpipvldgelvgal
    rpsdapltprqqealalsdeliaelkahdviviaapmynfnistqlknyfdlvaragvtf
    rytengpeglvtgkkaivitsrggihkdgptdlvtpylstflgfigitdvkfvfaegiay
    gpemaakaqsdakaaidsivsae