PDB entry 1tii

View 1tii on RCSB PDB site
Description: escherichia coli heat labile enterotoxin type iib
Deposited on 1996-03-20, released 1996-08-17
The last revision prior to the SCOP 1.65 freeze date was dated 1996-08-17, with a file datestamp of 1996-09-19.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.191
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1tii.1
  • Chain 'C':
    Domains in SCOP 1.65: d1tii.1
  • Chain 'D':
    Domains in SCOP 1.65: d1tiid_
  • Chain 'E':
    Domains in SCOP 1.65: d1tiie_
  • Chain 'F':
    Domains in SCOP 1.65: d1tiif_
  • Chain 'G':
    Domains in SCOP 1.65: d1tiig_
  • Chain 'H':
    Domains in SCOP 1.65: d1tiih_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tiiA (A:)
    ndyfradsrtpdevrrsggliprgqdeayergtpininlydhargtatgntryndgyvst
    tttlrqahllgqnmlggyneyyiyvvaaapnlfdvngvlgryspypseneyaalggipls
    qiigwyrvsfgaieggmhrnrdyrrdlfrglsaapnedgyriagfpdgfpaweevpwref
    apnsclpnnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tiiA (A:)
    ndyfradsrtpdevrrsggliprgqdeayergtpininlydhargttgntryndgyvstt
    ttlrqahllgqnmlggyneyyiyvvaaapnlfdvngvlgryspypseneyaalggiplsq
    iigwyrvsfgaieggmhrnrdyrrdlfrglsaapnedgyriagfpdgfpaweevpwrefa
    pnsclp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1tiiC (C:)
    assdttcasltnklsqhdladfkkyikrkftlmtllsinndgffsnnggkdel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tiiC (C:)
    ttcasltnklsqhdladfkkyikrkftlmtllsinn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1tiiD (D:)
    gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaieleae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tiiD (D:)
    gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaielea
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1tiiE (E:)
    gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaieleae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tiiE (E:)
    gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaielea
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1tiiF (F:)
    gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaieleae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tiiF (F:)
    gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaielea
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1tiiG (G:)
    gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaieleae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tiiG (G:)
    gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaielea
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1tiiH (H:)
    gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaieleae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tiiH (H:)
    gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaielea