PDB entry 1tif

View 1tif on RCSB PDB site
Description: translation initiation factor 3 n-terminal domain
Class: ribosome binding factor
Keywords: if3 n-terminal domain
Deposited on 1995-08-16, released 1995-12-07
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.192
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: translation initiation factor 3
    Species: Bacillus stearothermophilus
    Gene: T7
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1tifa_
  • Heterogens: PBM, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1tifA (A:)
mskdfiineqirarevrlidqngdqlgikskqealeiaarrnldlvlvapnakppvcrim
dygkfrfeqqkkekeark

    Sequence, based on observed residues (ATOM records): (download) 
    >1tifA (A:)
kdfiineqirarevrlidqngdqlgikskqealeiaarrnldlvlvapnakppvcrimdy
gkfrfeqqkkekeark