PDB entry 1tif

View 1tif on RCSB PDB site
Description: translation initiation factor 3 n-terminal domain
Deposited on 1995-08-16, released 1995-12-07
The last revision prior to the SCOP 1.55 freeze date was dated 1995-12-07, with a file datestamp of 1995-12-07.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.192
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1tif__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tif_ (-)
    kdfiineqirarevrlidqngdqlgikskqealeiaarrnldlvlvapnakppvcrimdy
    gkfrfeqqkkekeark