PDB entry 1tic

View 1tic on RCSB PDB site
Description: conformational lability of lipases observed in the absence of an oil- water interface: crystallographic studies of enzymes from the fungi humicola lanuginosa and rhizopus delemar
Deposited on 1993-12-06, released 1995-01-26
The last revision prior to the SCOP 1.55 freeze date was dated 1995-01-26, with a file datestamp of 1995-02-03.
Experiment type: -
Resolution: 2.6 Å
R-factor: 0.16
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1tica_
  • Chain 'B':
    Domains in SCOP 1.55: d1ticb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ticA (A:)
    kvvaattaqiqeftkyagiaataycrsvvpgnkwdcvqcqkwvpdgkiittftsllsdtn
    gyvlrsdkqktiylvfrgtnsfrsaitdivfnfsdykpvkgakvhagflssyeqvvndyf
    pvvqeqltahptykvivtghslggaqallagmdlyqreprlspknlsiftvggprvgnpt
    fayyvestgipfqrtvhkrdivphvppqsfgflhpgveswiksgtsnvqictseietkdc
    snsivpftsildhlsyfdinegscl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ticB (B:)
    sdggkvvaattaqiqeftkyagiaataycrsvvpgnkwdcvqcqkwvpdgkiittftsll
    sdtngyvlrsdkqktiylvfrgtnsfrsaitdivfnfsdykpvkgakvhagflssyeqvv
    ndyfpvvqeqltahptykvivtghslggaqallagmdlyqreprlspknlsiftvggprv
    gnptfayyvestgipfqrtvhkrdivphvppqsfgflhpgveswiksgtsnvqictseie
    tkdcsnsivpftsildhlsyfdinegscl