PDB entry 1tia

View 1tia on RCSB PDB site
Description: an unusual buried polar cluster in a family of fungal lipases
Deposited on 1993-12-06, released 1995-01-26
The last revision prior to the SCOP 1.55 freeze date was dated 1995-01-26, with a file datestamp of 1995-02-03.
Experiment type: -
Resolution: 2 Å
R-factor: 0.19
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1tia__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tia_ (-)
    dvstseldqfefwvqyaaasyyeadytaqvgdklscskgncpeveatgatvsydfsdsti
    tdtagyiavdhtnsavvlafrgsysvrnwvadatfvhtnpglcdgclaelgfwsswklvr
    ddiikelkevvaqnpnyelvvvghslgaavatlaatdlrgkgypsaklyayasprvgnaa
    lakyitaqgnnfrfthtndpvpklpllsmgyvhvspeywitspnnatvstsdikvidgdv
    sfdgntgtglplltdfeahiwyfvqvdagkg