PDB entry 1tia

View 1tia on RCSB PDB site
Description: an unusual buried polar cluster in a family of fungal lipases
Class: hydrolase(carboxylic esterase)
Keywords: hydrolase(carboxylic esterase)
Deposited on 1993-12-06, released 1995-01-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipase
    Species: Penicillium camemberti [TaxId:5075]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1tiaa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tiaA (A:)
    dvstseldqfefwvqyaaasyyeadytaqvgdklscskgncpeveatgatvsydfsdsti
    tdtagyiavdhtnsavvlafrgsysvrnwvadatfvhtnpglcdgclaelgfwsswklvr
    ddiikelkevvaqnpnyelvvvghslgaavatlaatdlrgkgypsaklyayasprvgnaa
    lakyitaqgnnfrfthtndpvpklpllsmgyvhvspeywitspnnatvstsdikvidgdv
    sfdgntgtglplltdfeahiwyfvqvdagkgpglpfkrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tiaA (A:)
    dvstseldqfefwvqyaaasyyeadytaqvgdklscskgncpeveatgatvsydfsdsti
    tdtagyiavdhtnsavvlafrgsysvrnwvadatfvhtnpglcdgclaelgfwsswklvr
    ddiikelkevvaqnpnyelvvvghslgaavatlaatdlrgkgypsaklyayasprvgnaa
    lakyitaqgnnfrfthtndpvpklpllsmgyvhvspeywitspnnatvstsdikvidgdv
    sfdgntgtglplltdfeahiwyfvqvdagkg