PDB entry 1ti9

View 1ti9 on RCSB PDB site
Description: A Model of the Ternary Complex Formed Between MarA, the alpha-CTD of RNA polymerase and DNA
Class: transcription/DNA
Keywords: protein-DNA complex, ternary complex, MarA, RNA polymerase
Deposited on 2004-06-02, released 2004-10-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2004-10-26, with a file datestamp of 2007-04-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Multiple antibiotic resistance protein marA
    Species: Escherichia coli
    Gene: MARA, B1531, Z2170, ECS2138, SF1563, S1690
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: r(p*gp*ap*tp*tp*tp*ap*gp*cp*ap*ap*ap*ap*cp*gp*tp*gp*gp*cp*ap*t
  • Chain 'C':
    Compound: r(p*ap*tp*gp*cp*cp*ap*cp*gp*tp*tp*tp*tp*gp*cp*tp*ap*ap*ap*tp*c)
  • Chain 'D':
    Compound: DNA-directed RNA polymerase alpha chain
    Species: Escherichia coli
    Gene: RPOA, PEZ, PHS, SEZ, B3295, C4056, Z4665, ECS4160, STM3415, STY4383, T4090, SF3327, S4435
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ti9d_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download) 
    >1ti9D (D:)
gshfdpillrpvddleltvrsanclkaeaihyigdlvqrtevellktpnlgkkslteikd
vlasrglslgmrlenwppasiade

    Sequence, based on observed residues (ATOM records): (download) 
    >1ti9D (D:)
fdpillrpvddleltvrsanclkaeaihyigdlvqrtevellktpnlgkkslteikdvla
srglslgmrlenwppasiade