PDB entry 1ti8

View 1ti8 on RCSB PDB site
Description: H7 Haemagglutinin
Class: Viral protein
Keywords: H7, haemagglutinin, Viral protein
Deposited on 2004-06-02, released 2005-06-21
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.23
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ti8a1
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q701T7 (0-End)
      • conflict (110)
    Domains in SCOPe 2.03: d1ti8b1
  • Heterogens: NAG, NDG, MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ti8A (A:)
    iclghhavsngtkvntltergvevvnatetvertnvpricskgkrtvdlgqcgllgtitg
    ppqcdqflefsadliierregsdvcypgkfvneealrqilresggidketmgftysgirt
    ngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkdpaliiwgihhsgstteq
    tklygsgnklitvgssnyqqsfvpspgarpqvngqsgridfhwlmlnpndtvtfsfngaf
    iapdrasflrgksmgiqssvqvdancegdcyhsggtiisnlpfqninsravgkcpryvkq
    eslmlatgmknvpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ti8B (B:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidneftevekqignvinwtrdsmtevwsynaellvamenqhtidltdsemnklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhsryreeamqnriq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ti8B (B:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidneftevekqignvinwtrdsmtevwsynaellvamenqhtidltdsemnklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhsryreea