PDB entry 1ti7

View 1ti7 on RCSB PDB site
Description: crystal structure of nmra, a negative transcriptional regulator, in complex with nadp at 1.7a resolution
Class: transcription
Keywords: rossmann fold, transcriptional regulation, short chain, dehydrogenase, reductase, nadp binding, nmra, transcription
Deposited on 2004-06-02, released 2004-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.173
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrogen metabolite repression regulator nmra
    Species: Emericella nidulans [TaxId:162425]
    Gene: nmrA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59919 (Start-351)
      • see remark 999 (237)
    Domains in SCOPe 2.07: d1ti7a_
  • Heterogens: K, CL, NAP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ti7A (A:)
    maqqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgpl
    lnnvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslyg
    pwpavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhap
    fdpdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrv
    tyvqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrpaagspkglgpangkg
    agagmmqgpggvisqrvtdearklwsgwrdmeeyarevfpieeeangldwml
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ti7A (A:)
    qqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgplln
    nvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslygpw
    pavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhapfd
    pdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrvty
    vqvpkveikvnipvgyreqleaievvfgehkapyfplpefpggvisqrvtdearklwsgw
    rdmeeyarevfpieeeangldwml