PDB entry 1ti4

View 1ti4 on RCSB PDB site
Description:
Deposited on 2004-06-02, released 2004-08-10
The last revision prior to the SCOP 1.71 freeze date was dated 2004-08-10, with a file datestamp of 2004-08-10.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.178
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ti4a1, d1ti4a2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ti4b1, d1ti4b2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ti4c1, d1ti4c2
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ti4d1, d1ti4d2
  • Chain 'E':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ti4e1, d1ti4e2
  • Chain 'F':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ti4f1, d1ti4f2
  • Chain 'G':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ti4g1, d1ti4g2
  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ti4h1, d1ti4h2
  • Chain 'I':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ti4i1, d1ti4i2
  • Chain 'J':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ti4j1, d1ti4j2
  • Chain 'K':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ti4k1, d1ti4k2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ti4l1, d1ti4l2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ti4A (A:)
    mgevvrltnsstggpvfvyvkdgkiirmtpmdfddavdapswkieargktftpprktsia
    pytagfksmiysdlripypmkrksfdpngernpqlrgaglskqdpwsdyeriswdeatdi
    vvaeinrikhaygpsailstpsshhmwgnvgyrhstyfrfmnmmgftyadhnpdswegwh
    wggmhmwgfswrlgnpeqydlledglkhaemivfwssdpetnsgiyagfesnirrqwlkd
    lgvdfvfidphmnhtarlvadkwfspkigtdhalsfaiaytwlkedsydkeyvaanahgf
    eewadyvlgktdgtpktcewaeeesgvpaceiralarqwakkntylaagglggwggacra
    shgiewargmialatmqgmgkpgsnmwsttqgvpldyefyfpgyaeggisgdcensaagf
    kfawrmfdgkttfpspsnlntsagqhiprlkipecimggkfqwsgkgfaggdishqlhqy
    eypapgyskikmfwkyggphlgtmtatnryakmythdslefvvsqsiwfegevpfadiil
    pactnferwdisefancsgyipdnyqlcnhrvislqakciepvgesmsdyeiyrlfakkl
    nieemfsegkdelawceqyfnatdmpkymtwdeffkkgyfvvpdnpnrkktvalrwfaeg
    rekdtpdwgprlnnqvcrkglqtttgkvefiatslknfeeqgyidehrpsmhtyvpawes
    qkhsplavkyplgmlsphprfsmhtmgdgknsymnyikdhrvevdgykywimrvnsidae
    argikngdlirayndrgsvilaaqvteclqpgtvhsyescavydplgtagksadrggcin
    iltpdryiskyacgmanntalveiekwdgdkyeiy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ti4B (B:)
    meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd
    inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee
    nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel
    gtkprvyyknlyrfeknyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdal
    dngeytveidadgksysdtvviddksvdlgfikl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ti4C (C:)
    mgevvrltnsstggpvfvyvkdgkiirmtpmdfddavdapswkieargktftpprktsia
    pytagfksmiysdlripypmkrksfdpngernpqlrgaglskqdpwsdyeriswdeatdi
    vvaeinrikhaygpsailstpsshhmwgnvgyrhstyfrfmnmmgftyadhnpdswegwh
    wggmhmwgfswrlgnpeqydlledglkhaemivfwssdpetnsgiyagfesnirrqwlkd
    lgvdfvfidphmnhtarlvadkwfspkigtdhalsfaiaytwlkedsydkeyvaanahgf
    eewadyvlgktdgtpktcewaeeesgvpaceiralarqwakkntylaagglggwggacra
    shgiewargmialatmqgmgkpgsnmwsttqgvpldyefyfpgyaeggisgdcensaagf
    kfawrmfdgkttfpspsnlntsagqhiprlkipecimggkfqwsgkgfaggdishqlhqy
    eypapgyskikmfwkyggphlgtmtatnryakmythdslefvvsqsiwfegevpfadiil
    pactnferwdisefancsgyipdnyqlcnhrvislqakciepvgesmsdyeiyrlfakkl
    nieemfsegkdelawceqyfnatdmpkymtwdeffkkgyfvvpdnpnrkktvalrwfaeg
    rekdtpdwgprlnnqvcrkglqtttgkvefiatslknfeeqgyidehrpsmhtyvpawes
    qkhsplavkyplgmlsphprfsmhtmgdgknsymnyikdhrvevdgykywimrvnsidae
    argikngdlirayndrgsvilaaqvteclqpgtvhsyescavydplgtagksadrggcin
    iltpdryiskyacgmanntalveiekwdgdkyeiy
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ti4D (D:)
    meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd
    inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee
    nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel
    gtkprvyyknlyrfeknyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdal
    dngeytveidadgksysdtvviddksvdlgfikl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ti4E (E:)
    mgevvrltnsstggpvfvyvkdgkiirmtpmdfddavdapswkieargktftpprktsia
    pytagfksmiysdlripypmkrksfdpngernpqlrgaglskqdpwsdyeriswdeatdi
    vvaeinrikhaygpsailstpsshhmwgnvgyrhstyfrfmnmmgftyadhnpdswegwh
    wggmhmwgfswrlgnpeqydlledglkhaemivfwssdpetnsgiyagfesnirrqwlkd
    lgvdfvfidphmnhtarlvadkwfspkigtdhalsfaiaytwlkedsydkeyvaanahgf
    eewadyvlgktdgtpktcewaeeesgvpaceiralarqwakkntylaagglggwggacra
    shgiewargmialatmqgmgkpgsnmwsttqgvpldyefyfpgyaeggisgdcensaagf
    kfawrmfdgkttfpspsnlntsagqhiprlkipecimggkfqwsgkgfaggdishqlhqy
    eypapgyskikmfwkyggphlgtmtatnryakmythdslefvvsqsiwfegevpfadiil
    pactnferwdisefancsgyipdnyqlcnhrvislqakciepvgesmsdyeiyrlfakkl
    nieemfsegkdelawceqyfnatdmpkymtwdeffkkgyfvvpdnpnrkktvalrwfaeg
    rekdtpdwgprlnnqvcrkglqtttgkvefiatslknfeeqgyidehrpsmhtyvpawes
    qkhsplavkyplgmlsphprfsmhtmgdgknsymnyikdhrvevdgykywimrvnsidae
    argikngdlirayndrgsvilaaqvteclqpgtvhsyescavydplgtagksadrggcin
    iltpdryiskyacgmanntalveiekwdgdkyeiy
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ti4F (F:)
    meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd
    inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee
    nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel
    gtkprvyyknlyrfeknyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdal
    dngeytveidadgksysdtvviddksvdlgfikl
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ti4G (G:)
    mgevvrltnsstggpvfvyvkdgkiirmtpmdfddavdapswkieargktftpprktsia
    pytagfksmiysdlripypmkrksfdpngernpqlrgaglskqdpwsdyeriswdeatdi
    vvaeinrikhaygpsailstpsshhmwgnvgyrhstyfrfmnmmgftyadhnpdswegwh
    wggmhmwgfswrlgnpeqydlledglkhaemivfwssdpetnsgiyagfesnirrqwlkd
    lgvdfvfidphmnhtarlvadkwfspkigtdhalsfaiaytwlkedsydkeyvaanahgf
    eewadyvlgktdgtpktcewaeeesgvpaceiralarqwakkntylaagglggwggacra
    shgiewargmialatmqgmgkpgsnmwsttqgvpldyefyfpgyaeggisgdcensaagf
    kfawrmfdgkttfpspsnlntsagqhiprlkipecimggkfqwsgkgfaggdishqlhqy
    eypapgyskikmfwkyggphlgtmtatnryakmythdslefvvsqsiwfegevpfadiil
    pactnferwdisefancsgyipdnyqlcnhrvislqakciepvgesmsdyeiyrlfakkl
    nieemfsegkdelawceqyfnatdmpkymtwdeffkkgyfvvpdnpnrkktvalrwfaeg
    rekdtpdwgprlnnqvcrkglqtttgkvefiatslknfeeqgyidehrpsmhtyvpawes
    qkhsplavkyplgmlsphprfsmhtmgdgknsymnyikdhrvevdgykywimrvnsidae
    argikngdlirayndrgsvilaaqvteclqpgtvhsyescavydplgtagksadrggcin
    iltpdryiskyacgmanntalveiekwdgdkyeiy
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ti4H (H:)
    meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd
    inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee
    nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel
    gtkprvyyknlyrfeknyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdal
    dngeytveidadgksysdtvviddksvdlgfikl
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ti4I (I:)
    mgevvrltnsstggpvfvyvkdgkiirmtpmdfddavdapswkieargktftpprktsia
    pytagfksmiysdlripypmkrksfdpngernpqlrgaglskqdpwsdyeriswdeatdi
    vvaeinrikhaygpsailstpsshhmwgnvgyrhstyfrfmnmmgftyadhnpdswegwh
    wggmhmwgfswrlgnpeqydlledglkhaemivfwssdpetnsgiyagfesnirrqwlkd
    lgvdfvfidphmnhtarlvadkwfspkigtdhalsfaiaytwlkedsydkeyvaanahgf
    eewadyvlgktdgtpktcewaeeesgvpaceiralarqwakkntylaagglggwggacra
    shgiewargmialatmqgmgkpgsnmwsttqgvpldyefyfpgyaeggisgdcensaagf
    kfawrmfdgkttfpspsnlntsagqhiprlkipecimggkfqwsgkgfaggdishqlhqy
    eypapgyskikmfwkyggphlgtmtatnryakmythdslefvvsqsiwfegevpfadiil
    pactnferwdisefancsgyipdnyqlcnhrvislqakciepvgesmsdyeiyrlfakkl
    nieemfsegkdelawceqyfnatdmpkymtwdeffkkgyfvvpdnpnrkktvalrwfaeg
    rekdtpdwgprlnnqvcrkglqtttgkvefiatslknfeeqgyidehrpsmhtyvpawes
    qkhsplavkyplgmlsphprfsmhtmgdgknsymnyikdhrvevdgykywimrvnsidae
    argikngdlirayndrgsvilaaqvteclqpgtvhsyescavydplgtagksadrggcin
    iltpdryiskyacgmanntalveiekwdgdkyeiy
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ti4J (J:)
    meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd
    inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee
    nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel
    gtkprvyyknlyrfeknyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdal
    dngeytveidadgksysdtvviddksvdlgfikl
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ti4K (K:)
    mgevvrltnsstggpvfvyvkdgkiirmtpmdfddavdapswkieargktftpprktsia
    pytagfksmiysdlripypmkrksfdpngernpqlrgaglskqdpwsdyeriswdeatdi
    vvaeinrikhaygpsailstpsshhmwgnvgyrhstyfrfmnmmgftyadhnpdswegwh
    wggmhmwgfswrlgnpeqydlledglkhaemivfwssdpetnsgiyagfesnirrqwlkd
    lgvdfvfidphmnhtarlvadkwfspkigtdhalsfaiaytwlkedsydkeyvaanahgf
    eewadyvlgktdgtpktcewaeeesgvpaceiralarqwakkntylaagglggwggacra
    shgiewargmialatmqgmgkpgsnmwsttqgvpldyefyfpgyaeggisgdcensaagf
    kfawrmfdgkttfpspsnlntsagqhiprlkipecimggkfqwsgkgfaggdishqlhqy
    eypapgyskikmfwkyggphlgtmtatnryakmythdslefvvsqsiwfegevpfadiil
    pactnferwdisefancsgyipdnyqlcnhrvislqakciepvgesmsdyeiyrlfakkl
    nieemfsegkdelawceqyfnatdmpkymtwdeffkkgyfvvpdnpnrkktvalrwfaeg
    rekdtpdwgprlnnqvcrkglqtttgkvefiatslknfeeqgyidehrpsmhtyvpawes
    qkhsplavkyplgmlsphprfsmhtmgdgknsymnyikdhrvevdgykywimrvnsidae
    argikngdlirayndrgsvilaaqvteclqpgtvhsyescavydplgtagksadrggcin
    iltpdryiskyacgmanntalveiekwdgdkyeiy
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ti4L (L:)
    meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd
    inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee
    nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel
    gtkprvyyknlyrfeknyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdal
    dngeytveidadgksysdtvviddksvdlgfikl