PDB entry 1ti3

View 1ti3 on RCSB PDB site
Description: Solution structure of the Thioredoxin h1 from poplar, a CPPC active site variant
Class: oxidoreductase
Keywords: oxidoreductase, thioredoxin, NMR
Deposited on 2004-06-02, released 2004-12-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: thioredoxin H
  Species: Populus tremula [TaxId:113636]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8S3L3 (0-112)
  Domains in SCOPe 2.08: d1ti3a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ti3A (A:)
  aeegqviachtvdtwkehfekgkgsqklivvdftaswcppckmiapifaelakkfpnvtf
  lkvdvdelkavaeewnveamptfiflkdgklvdktvgadkdglptlvakhata