PDB entry 1ti1

View 1ti1 on RCSB PDB site
Description: crystal structure of a mutant DsbA
Class: oxidoreductase
Keywords: oxidoreductase, proline, thiol, detergent
Deposited on 2004-06-02, released 2005-05-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.247
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thiol:disulfide interchange protein dsbA
    Species: Escherichia coli [TaxId:83334]
    Gene: DSBA, PPFA, DSF, B3860, Z5392, ECS4783
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24991
      • engineered (32)
    Domains in SCOPe 2.06: d1ti1a_
  • Heterogens: D12, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ti1A (A:)
    aqyedgkqyttlekpvagapqvleffsffcphayqfeevlhisdnvkkklpegvkmtkyh
    vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
    eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
    tvkylsekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ti1A (A:)
    yedgkqyttlekpvagapqvleffsffcphayqfeevlhisdnvkkklpegvkmtkyhvn
    fmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikgeey
    daawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyadtv
    kylsek