PDB entry 1ti0

View 1ti0 on RCSB PDB site
Description: Binding of Non-steroidal anti-inflammatory drugs to phospholipase A2: Crystal structure of the complex formed between phospholipase A2 and Indomethacin at 1.4A resolution.
Class: hydrolase
Keywords: Phospholipase A2,indomethacin,complex,crystal structure, 1.4A resolution
Deposited on 2004-06-02, released 2004-06-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2006-08-15, with a file datestamp of 2007-06-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.188
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase a2
  Species: Daboia russelli russelli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P59071 (0-120)
  Domains in SCOPe 2.08: d1ti0a_
• Heterogens: SO4, IMN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ti0A (A:)
  sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
  sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
  c