PDB entry 1thz

View 1thz on RCSB PDB site
Description: Crystal Structure of Avian AICAR Transformylase in Complex with a Novel Inhibitor Identified by Virtual Ligand Screening
Deposited on 2004-06-01, released 2004-09-07
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-07, with a file datestamp of 2004-09-07.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.214
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1thzA (A:)
    maarqqlallsvsekaglvefarslnalglgliasggtatalrdaglpvrdvsdltgfpe
    mlggrvktlhpavhagilarnipednadmnkqdfslvrvvvcnlypfvktvsspgvtvpe
    avekidiggvallraaaknharvtvvcdpadyssvakemaaskdkdtsvetrrhlalkaf
    thtaqydaaisdyfrkeyskgvsqlplrygmnphqspaqlyttrpklpltvvngspgfin
    lcdalnawqlvkelkqalgipaaasfkhvspagaavgiplseeeaqvcmvhdlhktltpl
    asayarsrgadrmssfgdfialsdicdvptakiisrevsdgvvapgyeeealkilskkkn
    ggycvlqmdpnyepddneirtlyglqlmqkrnnavidrslfknivtknktlpesavrdli
    vasiavkytqsnsvcyakdgqvigigagqqsrihctrlagdkanswwlrhhprvlsmkfk
    agvkraevsnaidqyvtgtigededlvkwqamfeevpaqlteaekkqwiakltavslssd
    affpfrdnvdrakrigvqfivapsgsaadevvieacnelgitlihtnlrlfhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1thzA (A:)
    rqqlallsvsekaglvefarslnalglgliasggtatalrdaglpvrdvsdltgfpemlg
    grvktlhpavhagilarnipednadmnkqdfslvrvvvcnlypfvktvsspgvtvpeave
    kidiggvallraaaknharvtvvcdpadyssvakemaaskdkdtsvetrrhlalkaftht
    aqydaaisdyfrkeyskgvsqlplrygmnphqspaqlyttrpklpltvvngspgfinlcd
    alnawqlvkelkqalgipaaasfkhvspagaavgiplseeeaqvcmvhdlhktltplasa
    yarsrgadrmssfgdfialsdicdvptakiisrevsdgvvapgyeeealkilskkknggy
    cvlqmdpnyepddneirtlyglqlmqkrnnavidrslfknivtknktlpesavrdlivas
    iavkytqsnsvcyakdgqvigigagqqsrihctrlagdkanswwlrhhprvlsmkfkagv
    kraevsnaidqyvtgtigededlvkwqamfeevpaqlteaekkqwiakltavslssdaff
    pfrdnvdrakrigvqfivapsgsaadevvieacnelgitlihtnlrlfhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1thzB (B:)
    maarqqlallsvsekaglvefarslnalglgliasggtatalrdaglpvrdvsdltgfpe
    mlggrvktlhpavhagilarnipednadmnkqdfslvrvvvcnlypfvktvsspgvtvpe
    avekidiggvallraaaknharvtvvcdpadyssvakemaaskdkdtsvetrrhlalkaf
    thtaqydaaisdyfrkeyskgvsqlplrygmnphqspaqlyttrpklpltvvngspgfin
    lcdalnawqlvkelkqalgipaaasfkhvspagaavgiplseeeaqvcmvhdlhktltpl
    asayarsrgadrmssfgdfialsdicdvptakiisrevsdgvvapgyeeealkilskkkn
    ggycvlqmdpnyepddneirtlyglqlmqkrnnavidrslfknivtknktlpesavrdli
    vasiavkytqsnsvcyakdgqvigigagqqsrihctrlagdkanswwlrhhprvlsmkfk
    agvkraevsnaidqyvtgtigededlvkwqamfeevpaqlteaekkqwiakltavslssd
    affpfrdnvdrakrigvqfivapsgsaadevvieacnelgitlihtnlrlfhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1thzB (B:)
    rqqlallsvsekaglvefarslnalglgliasggtatalrdaglpvrdvsdltgfpemlg
    grvktlhpavhagilarnipednadmnkqdfslvrvvvcnlypfvktvsspgvtvpeave
    kidiggvallraaaknharvtvvcdpadyssvakemaaskdkdtsvetrrhlalkaftht
    aqydaaisdyfrkeyskgvsqlplrygmnphqspaqlyttrpklpltvvngspgfinlcd
    alnawqlvkelkqalgipaaasfkhvspagaavgiplseeeaqvcmvhdlhktltplasa
    yarsrgadrmssfgdfialsdicdvptakiisrevsdgvvapgyeeealkilskkknggy
    cvlqmdpnyepddneirtlyglqlmqkrnnavidrslfknivtknktlpesavrdlivas
    iavkytqsnsvcyakdgqvigigagqqsrihctrlagdkanswwlrhhprvlsmkfkagv
    kraevsnaidqyvtgtigededlvkwqamfeevpaqlteaekkqwiakltavslssdaff
    pfrdnvdrakrigvqfivapsgsaadevvieacnelgitlihtnlrlfhh