PDB entry 1thv

View 1thv on RCSB PDB site
Description: the structures of three crystal forms of the sweet protein thaumatin
Class: sweet tasting protein
Keywords: sweet tasting protein
Deposited on 1994-06-10, released 1994-12-20
The last revision prior to the SCOP 1.75 freeze date was dated 1994-12-20, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.165
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thaumatin isoform a
    Species: Thaumatococcus daniellii
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02883 (0-206)
      • conflict (112)
    Domains in SCOP 1.75: d1thva_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1thvA (A:)
    atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
    sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmdfspttrg
    crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
    fsyvldkpttvtcpgssnyrvtfcpta