PDB entry 1tht

View 1tht on RCSB PDB site
Description: structure of a myristoyl-acp-specific thioesterase from vibrio harveyi
Deposited on 1994-04-19, released 1995-06-07
The last revision prior to the SCOP 1.71 freeze date was dated 1995-07-20, with a file datestamp of 1995-08-14.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.227
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1thta_
  • Chain 'B':
    Domains in SCOP 1.71: d1thtb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1thtA (A:)
    mnnqcktiahvlrvnngqelhvwetppkenvpfknntiliasgfarrmdhfaglaeylst
    ngfhvfrydslhhvglssgsideftmttgknslctvyhwlqtkgtqnigliaaslsarva
    yevisdlelsflitavgvvnlrdtlekalgfdylslpidelpndldfeghklgsevfvrd
    cfehhwdtldstldkvantsvpliaftannddwvkqeevydmlahirtghcklysllgss
    hdlgenlvvlrnfyqsvtkaaiamdggsleidvdfiepdfeqltiatvnerrlkaeienr
    tpema
    

    Sequence, based on observed residues (ATOM records): (download)
    >1thtA (A:)
    qcktiahvlrvnngqelhvwetppkenvpfknntiliasgfarrmdhfaglaeylstngf
    hvfrydslhhveftmttgknslctvyhwlqtkgtqnigliaaslsarvayevisdlelsf
    litavgvvnlrdtlekalgfdylslpidelpndldfeghklgsevfvrdcfehhwdtlds
    tldkvantsvpliaftannddwvkqeevydmlahirtghcklysllgsshdlgenlvvlr
    nfyqsvtkaaiamdggsleidvdfiepdfeqltiatvnerrlkaeienrtpema
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1thtB (B:)
    mnnqcktiahvlrvnngqelhvwetppkenvpfknntiliasgfarrmdhfaglaeylst
    ngfhvfrydslhhvglssgsideftmttgknslctvyhwlqtkgtqnigliaaslsarva
    yevisdlelsflitavgvvnlrdtlekalgfdylslpidelpndldfeghklgsevfvrd
    cfehhwdtldstldkvantsvpliaftannddwvkqeevydmlahirtghcklysllgss
    hdlgenlvvlrnfyqsvtkaaiamdggsleidvdfiepdfeqltiatvnerrlkaeienr
    tpema
    

    Sequence, based on observed residues (ATOM records): (download)
    >1thtB (B:)
    qcktiahvlrvnngqelhvwetppkenvpfknntiliasgfarrmdhfaglaeylstngf
    hvfrydslhheftmttgknslctvyhwlqtkgtqnigliaaslsarvayevisdlelsfl
    itavgvvnlrdtlekalgfdylslpidelpndldfeghklgsevfvrdcfehhwdtldst
    ldkvantsvpliaftannddwvkqeevydmlahirtghcklysllgsshdlgenlvvlrn
    fyqsvtkaaiamdggsleidvdfiepdfeqltiatvnerrlkaeienrtpema