PDB entry 1thq

View 1thq on RCSB PDB site
Description: Crystal Structure of Outer Membrane Enzyme PagP
Class: transferase
Keywords: palmitoyltransferase, beta-barrel, outer membrane enzyme, pagp, TRANSFERASE
Deposited on 2004-06-01, released 2004-08-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.218
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CrcA protein
    Species: Escherichia coli [TaxId:562]
    Gene: CRCA, B0622
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37001 (Start-161)
      • cloning artifact (162-163)
    Domains in SCOPe 2.06: d1thqa1, d1thqa2
  • Heterogens: ACT, LDA, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1thqA (A:)
    mnadewmttfreniaqtwqqpehydlyipaitwharfaydkektdrynerpwgggfglsr
    wdekgnwhglyamafkdswnkwepiagygwestwrpladenfhlglgftagvtardnwny
    iplpvllplasvgygpvtfqmtyipgtynngnvyfawmrfqflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1thqA (A:)
    ttfreniaqtwqqpehydlyipaitwharfaerpwgggfglsrwdekgnwhglyamafkd
    swnkwepiagygwestwrpladenfhlglgftagvtardnwnyiplpvllplasvgygpv
    tfqmtyipgtynngnvyfawmrfqfle