PDB entry 1thm

View 1thm on RCSB PDB site
Description: crystal structure of thermitase at 1.4 angstroms resolution
Class: hydrolase(serine protease)
Keywords: hydrolase(serine protease)
Deposited on 1992-02-24, released 1994-01-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.37 Å
R-factor: 0.166
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thermitase
    Species: Thermoactinomyces vulgaris [TaxId:2026]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04072 (0-278)
      • conflict (198)
      • conflict (207)
    Domains in SCOPe 2.04: d1thma_
  • Heterogens: CA, NA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1thmA (A:)
ytpndpyfssrqygpqkiqapqawdiaegsgakiaivdtgvqsnhpdlagkvvggwdfvd
ndstpqngnghgthcagiaaavtnnstgiagtapkasilavrvldnsgsgtwtavangit
yaadqgakvislslggtvgnsglqqavnyawnkgsvvvaaagnagntapnypayysnaia
vastdqndnkssfstygswvdvaapgssiystyptstyaslsgtsmatphvagvagllas
qgrsasniraaientadkisgtgtywakgrvnaykavqy