PDB entry 1thf

View 1thf on RCSB PDB site
Description: cyclase subunit of imidazoleglycerolphosphate synthase from thermotoga maritima
Class: lyase
Keywords: thermophile, tim-barrel, histidine biosynthesis, lyase, phosphate-binding sites
Deposited on 1998-09-17, released 2000-07-14
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.198
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: hisf protein
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0C6 (0-252)
      • conflict (20)
    Domains in SCOPe 2.03: d1thfd_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1thfD (D:)
mlakriiacldvkdgrvvkgsnfenlrdsgdpvelgkfyseigidelvflditasvekrk
tmlelvekvaeqidipftvgggihdfetaselilrgadkvsintaavenpslitqiaqtf
gsqavvvaidakrvdgefmvftysgkkntgillrdwvvevekrgageilltsidrdgtks
gydtemirfvrplttlpiiasggagkmehfleaflagadaalaasvfhfreidvrelkey
lkkhgvnvrlegl