PDB entry 1thd

View 1thd on RCSB PDB site
Description: complex organization of dengue virus e protein as revealed by 9.5 angstrom cryo-em reconstruction
Class: Virus
Keywords: FLAVIVIRUS, FLAVIVIRIDAE, DENGUE VIRUS, GLYCOPROTEIN E, CRYO-EM, CRYO-ELECTRON MICROSCOPY, Icosahedral virus
Deposited on 2004-06-01, released 2004-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-08-04, with a file datestamp of 2009-07-31.
Experiment type: EM
Resolution: 9.5 Å
R-factor: N/A
AEROSPACI score: -0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major envelope protein E
    Species: Dengue virus 2 Puerto Rico/PR159-S1/1969 [TaxId:11066]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12823 (0-394)
      • conflict (334)
      • conflict (351)
    Domains in SCOPe 2.07: d1thda1, d1thda2
  • Chain 'B':
    Compound: major envelope protein E
    Species: Dengue virus 2 Puerto Rico/PR159-S1/1969 [TaxId:11066]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12823 (0-394)
      • conflict (334)
      • conflict (351)
    Domains in SCOPe 2.07: d1thdb1, d1thdb2
  • Chain 'C':
    Compound: major envelope protein E
    Species: Dengue virus 2 Puerto Rico/PR159-S1/1969 [TaxId:11066]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12823 (0-394)
      • conflict (334)
      • conflict (351)
    Domains in SCOPe 2.07: d1thdc1, d1thdc2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1thdA (A:)
    mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc
    ieakltntttdsrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamft
    ckknmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygt
    vtmecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf
    knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgmsys
    mctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpivte
    kdspvnieaeppfgdsyiiigvepgqlkldwfkkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1thdA (A:)
    mrcigisnrdfvegvsswvdivlehgscvttmaknkptldfelikteakqpatlrkycie
    akltntttdsrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamftck
    knmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygtvt
    mecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgagsnwiqketlvtfknpha
    kkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgmsysmctgk
    fkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpivtekdspv
    nieaeppfgdsyiiigvepgqlkldwfkkg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1thdB (B:)
    mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc
    ieakltntttdsrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamft
    ckknmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygt
    vtmecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf
    knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgmsys
    mctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpivte
    kdspvnieaeppfgdsyiiigvepgqlkldwfkkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1thdB (B:)
    mrcigisnrdfvegvsswvdivlehgscvttmaknkptldfelikteakqpatlrkycie
    akltntttdsrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamftck
    knmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygtvt
    mecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgagsnwiqketlvtfknpha
    kkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgmsysmctgk
    fkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpivtekdspv
    nieaeppfgdsyiiigvepgqlkldwfkkg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1thdC (C:)
    mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc
    ieakltntttdsrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamft
    ckknmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygt
    vtmecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf
    knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgmsys
    mctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpivte
    kdspvnieaeppfgdsyiiigvepgqlkldwfkkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1thdC (C:)
    mrcigisnrdfvegvsswvdivlehgscvttmaknkptldfelikteakqpatlrkycie
    akltntttdsrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamftck
    knmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygtvt
    mecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgagsnwiqketlvtfknpha
    kkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgmsysmctgk
    fkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpivtekdspv
    nieaeppfgdsyiiigvepgqlkldwfkkg