PDB entry 1thc

View 1thc on RCSB PDB site
Description: crystal structure determination at 2.3a of human transthyretin-3',5'-dibromo-2',4,4',6-tetra-hydroxyaurone complex
Class: transport (thyroxine,retinol) in serum
Keywords: transport (thyroxine, retinol) in serum
Deposited on 1992-04-20, released 1993-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1thca_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1thcb_
  • Heterogens: FL9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1thcA (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeqfvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1thcA (A:)
    kcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeqfvegi
    ykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1thcB (B:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeqfvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1thcB (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeqfvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn