PDB entry 1th7

View 1th7 on RCSB PDB site
Description: Crystal Structure of an Archaeal Sm Protein from Sulfolobus solfataricus
Class: RNA binding protein
Keywords: archaea; SM protein; SM fold; SS-SM1, RNA BINDING PROTEIN
Deposited on 2004-06-01, released 2005-06-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: 0.217
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Small nuclear riboprotein protein
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: snRNP-2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97ZQ0 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.06: d1th7a1, d1th7a2
  • Chain 'B':
    Compound: Small nuclear riboprotein protein
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: snRNP-2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97ZQ0 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.06: d1th7b2, d1th7b3
  • Chain 'C':
    Compound: Small nuclear riboprotein protein
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: snRNP-2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97ZQ0 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.06: d1th7c2, d1th7c3
  • Chain 'D':
    Compound: Small nuclear riboprotein protein
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: snRNP-2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97ZQ0 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.06: d1th7d2, d1th7d3
  • Chain 'E':
    Compound: Small nuclear riboprotein protein
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: snRNP-2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97ZQ0 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.06: d1th7e2, d1th7e3
  • Chain 'F':
    Compound: Small nuclear riboprotein protein
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: snRNP-2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97ZQ0 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.06: d1th7f2, d1th7f3
  • Chain 'G':
    Compound: Small nuclear riboprotein protein
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: snRNP-2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97ZQ0 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.06: d1th7g2, d1th7g3
  • Chain 'H':
    Compound: Small nuclear riboprotein protein
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: snRNP-2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97ZQ0 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.06: d1th7h2, d1th7h3
  • Chain 'I':
    Compound: Small nuclear riboprotein protein
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: snRNP-2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97ZQ0 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.06: d1th7i2, d1th7i3
  • Chain 'J':
    Compound: Small nuclear riboprotein protein
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: snRNP-2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97ZQ0 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.06: d1th7j2, d1th7j3
  • Chain 'K':
    Compound: Small nuclear riboprotein protein
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: snRNP-2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97ZQ0 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.06: d1th7k2, d1th7k3
  • Chain 'L':
    Compound: Small nuclear riboprotein protein
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: snRNP-2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97ZQ0 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.06: d1th7l2, d1th7l3
  • Chain 'M':
    Compound: Small nuclear riboprotein protein
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: snRNP-2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97ZQ0 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.06: d1th7m2, d1th7m3
  • Chain 'N':
    Compound: Small nuclear riboprotein protein
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: snRNP-2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97ZQ0 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.06: d1th7n2, d1th7n3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1th7A (A:)
    gamnflaetahkvlaeslnnlvlvklkgnkevrgmlrsydqhmnlvlsdseeiqsdgsgk
    klgtivirgdnvilisplqts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1th7A (A:)
    gamnflaetahkvlaeslnnlvlvklkgnkevrgmlrsydqhmnlvlsdseeiqsdgsgk
    klgtivirgdnvilispl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1th7B (B:)
    gamnflaetahkvlaeslnnlvlvklkgnkevrgmlrsydqhmnlvlsdseeiqsdgsgk
    klgtivirgdnvilisplqts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1th7B (B:)
    gamnflaetahkvlaeslnnlvlvklkgnkevrgmlrsydqhmnlvlsdseeiqsdgsgk
    klgtivirgdnvilispl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1th7C (C:)
    gamnflaetahkvlaeslnnlvlvklkgnkevrgmlrsydqhmnlvlsdseeiqsdgsgk
    klgtivirgdnvilisplqts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1th7C (C:)
    gamnflaetahkvlaeslnnlvlvklkgnkevrgmlrsydqhmnlvlsdseeiqsdgsgk
    klgtivirgdnvilispl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1th7D (D:)
    gamnflaetahkvlaeslnnlvlvklkgnkevrgmlrsydqhmnlvlsdseeiqsdgsgk
    klgtivirgdnvilisplqts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1th7D (D:)
    gamnflaetahkvlaeslnnlvlvklkgnkevrgmlrsydqhmnlvlsdseeiqsdgsgk
    klgtivirgdnvilispl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1th7E (E:)
    gamnflaetahkvlaeslnnlvlvklkgnkevrgmlrsydqhmnlvlsdseeiqsdgsgk
    klgtivirgdnvilisplqts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1th7E (E:)
    gamnflaetahkvlaeslnnlvlvklkgnkevrgmlrsydqhmnlvlsdseeiqsdgsgk
    klgtivirgdnvilispl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1th7F (F:)
    gamnflaetahkvlaeslnnlvlvklkgnkevrgmlrsydqhmnlvlsdseeiqsdgsgk
    klgtivirgdnvilisplqts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1th7F (F:)
    gamnflaetahkvlaeslnnlvlvklkgnkevrgmlrsydqhmnlvlsdseeiqsdgsgk
    klgtivirgdnvilispl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1th7G (G:)
    gamnflaetahkvlaeslnnlvlvklkgnkevrgmlrsydqhmnlvlsdseeiqsdgsgk
    klgtivirgdnvilisplqts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1th7G (G:)
    gamnflaetahkvlaeslnnlvlvklkgnkevrgmlrsydqhmnlvlsdseeiqsdgsgk
    klgtivirgdnvilispl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1th7H (H:)
    gamnflaetahkvlaeslnnlvlvklkgnkevrgmlrsydqhmnlvlsdseeiqsdgsgk
    klgtivirgdnvilisplqts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1th7H (H:)
    gamnflaetahkvlaeslnnlvlvklkgnkevrgmlrsydqhmnlvlsdseeiqsdgsgk
    klgtivirgdnvilispl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1th7I (I:)
    gamnflaetahkvlaeslnnlvlvklkgnkevrgmlrsydqhmnlvlsdseeiqsdgsgk
    klgtivirgdnvilisplqts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1th7I (I:)
    gamnflaetahkvlaeslnnlvlvklkgnkevrgmlrsydqhmnlvlsdseeiqsdgsgk
    klgtivirgdnvilispl
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1th7J (J:)
    gamnflaetahkvlaeslnnlvlvklkgnkevrgmlrsydqhmnlvlsdseeiqsdgsgk
    klgtivirgdnvilisplqts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1th7J (J:)
    gamnflaetahkvlaeslnnlvlvklkgnkevrgmlrsydqhmnlvlsdseeiqsdgsgk
    klgtivirgdnvilispl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1th7K (K:)
    gamnflaetahkvlaeslnnlvlvklkgnkevrgmlrsydqhmnlvlsdseeiqsdgsgk
    klgtivirgdnvilisplqts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1th7K (K:)
    gamnflaetahkvlaeslnnlvlvklkgnkevrgmlrsydqhmnlvlsdseeiqsdgsgk
    klgtivirgdnvilispl
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1th7L (L:)
    gamnflaetahkvlaeslnnlvlvklkgnkevrgmlrsydqhmnlvlsdseeiqsdgsgk
    klgtivirgdnvilisplqts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1th7L (L:)
    gamnflaetahkvlaeslnnlvlvklkgnkevrgmlrsydqhmnlvlsdseeiqsdgsgk
    klgtivirgdnvilispl
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1th7M (M:)
    gamnflaetahkvlaeslnnlvlvklkgnkevrgmlrsydqhmnlvlsdseeiqsdgsgk
    klgtivirgdnvilisplqts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1th7M (M:)
    gamnflaetahkvlaeslnnlvlvklkgnkevrgmlrsydqhmnlvlsdseeiqsdgsgk
    klgtivirgdnvilispl
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1th7N (N:)
    gamnflaetahkvlaeslnnlvlvklkgnkevrgmlrsydqhmnlvlsdseeiqsdgsgk
    klgtivirgdnvilisplqts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1th7N (N:)
    gamnflaetahkvlaeslnnlvlvklkgnkevrgmlrsydqhmnlvlsdseeiqsdgsgk
    klgtivirgdnvilispl