SCOPe 2.08: Structural Classification of Proteins

PDB entry 1th7

View 1th7 on RCSB PDB site
Description: Crystal Structure of an Archaeal Sm Protein from Sulfolobus solfataricus
Class: RNA binding protein
Keywords: archaea; SM protein; SM fold; SS-SM1, RNA BINDING PROTEIN
Deposited on 2004-06-01, released 2005-06-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: 0.217
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Small nuclear riboprotein protein
Species: Sulfolobus solfataricus [TaxId:2287]
Gene: snRNP-2
Database cross-references and differences (RAF-indexed):
- Uniprot Q97ZQ0 (2-End)
  - cloning artifact (0-1)
Domains in SCOPe 2.08: d1th7a1, d1th7a2
Chain 'B':
Compound: Small nuclear riboprotein protein
Species: Sulfolobus solfataricus [TaxId:2287]
Gene: snRNP-2
Database cross-references and differences (RAF-indexed):
- Uniprot Q97ZQ0 (2-End)
  - cloning artifact (0-1)
Domains in SCOPe 2.08: d1th7b2, d1th7b3
Chain 'C':
Compound: Small nuclear riboprotein protein
Species: Sulfolobus solfataricus [TaxId:2287]
Gene: snRNP-2
Database cross-references and differences (RAF-indexed):
- Uniprot Q97ZQ0 (2-End)
  - cloning artifact (0-1)
Domains in SCOPe 2.08: d1th7c2, d1th7c3
Chain 'D':
Compound: Small nuclear riboprotein protein
Species: Sulfolobus solfataricus [TaxId:2287]
Gene: snRNP-2
Database cross-references and differences (RAF-indexed):
- Uniprot Q97ZQ0 (2-End)
  - cloning artifact (0-1)
Domains in SCOPe 2.08: d1th7d2, d1th7d3
Chain 'E':
Compound: Small nuclear riboprotein protein
Species: Sulfolobus solfataricus [TaxId:2287]
Gene: snRNP-2
Database cross-references and differences (RAF-indexed):
- Uniprot Q97ZQ0 (2-End)
  - cloning artifact (0-1)
Domains in SCOPe 2.08: d1th7e2, d1th7e3
Chain 'F':
Compound: Small nuclear riboprotein protein
Species: Sulfolobus solfataricus [TaxId:2287]
Gene: snRNP-2
Database cross-references and differences (RAF-indexed):
- Uniprot Q97ZQ0 (2-End)
  - cloning artifact (0-1)
Domains in SCOPe 2.08: d1th7f2, d1th7f3
Chain 'G':
Compound: Small nuclear riboprotein protein
Species: Sulfolobus solfataricus [TaxId:2287]
Gene: snRNP-2
Database cross-references and differences (RAF-indexed):
- Uniprot Q97ZQ0 (2-End)
  - cloning artifact (0-1)
Domains in SCOPe 2.08: d1th7g2, d1th7g3
Chain 'H':
Compound: Small nuclear riboprotein protein
Species: Sulfolobus solfataricus [TaxId:2287]
Gene: snRNP-2
Database cross-references and differences (RAF-indexed):
- Uniprot Q97ZQ0 (2-End)
  - cloning artifact (0-1)
Domains in SCOPe 2.08: d1th7h2, d1th7h3
Chain 'I':
Compound: Small nuclear riboprotein protein
Species: Sulfolobus solfataricus [TaxId:2287]
Gene: snRNP-2
Database cross-references and differences (RAF-indexed):
- Uniprot Q97ZQ0 (2-End)
  - cloning artifact (0-1)
Domains in SCOPe 2.08: d1th7i2, d1th7i3
Chain 'J':
Compound: Small nuclear riboprotein protein
Species: Sulfolobus solfataricus [TaxId:2287]
Gene: snRNP-2
Database cross-references and differences (RAF-indexed):
- Uniprot Q97ZQ0 (2-End)
  - cloning artifact (0-1)
Domains in SCOPe 2.08: d1th7j2, d1th7j3
Chain 'K':
Compound: Small nuclear riboprotein protein
Species: Sulfolobus solfataricus [TaxId:2287]
Gene: snRNP-2
Database cross-references and differences (RAF-indexed):
- Uniprot Q97ZQ0 (2-End)
  - cloning artifact (0-1)
Domains in SCOPe 2.08: d1th7k2, d1th7k3
Chain 'L':
Compound: Small nuclear riboprotein protein
Species: Sulfolobus solfataricus [TaxId:2287]
Gene: snRNP-2
Database cross-references and differences (RAF-indexed):
- Uniprot Q97ZQ0 (2-End)
  - cloning artifact (0-1)
Domains in SCOPe 2.08: d1th7l2, d1th7l3
Chain 'M':
Compound: Small nuclear riboprotein protein
Species: Sulfolobus solfataricus [TaxId:2287]
Gene: snRNP-2
Database cross-references and differences (RAF-indexed):
- Uniprot Q97ZQ0 (2-End)
  - cloning artifact (0-1)
Domains in SCOPe 2.08: d1th7m2, d1th7m3
Chain 'N':
Compound: Small nuclear riboprotein protein
Species: Sulfolobus solfataricus [TaxId:2287]
Gene: snRNP-2
Database cross-references and differences (RAF-indexed):
- Uniprot Q97ZQ0 (2-End)
  - cloning artifact (0-1)
Domains in SCOPe 2.08: d1th7n2, d1th7n3
Heterogens: HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1th7A (A:)
gamnflaetahkvlaeslnnlvlvklkgnkevrgmlrsydqhmnlvlsdseeiqsdgsgk
klgtivirgdnvilisplqts