PDB entry 1th6

View 1th6 on RCSB PDB site
Description: Crystal structure of phospholipase A2 in complex with atropine at 1.23A resolution
Deposited on 2004-06-01, released 2004-06-15
The last revision prior to the SCOP 1.71 freeze date was dated 2004-06-15, with a file datestamp of 2004-06-15.
Experiment type: XRAY
Resolution: 1.23 Å
R-factor: 0.189
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1th6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1th6A (A:)
    sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
    sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
    c