PDB entry 1th6

View 1th6 on RCSB PDB site
Description: Crystal structure of phospholipase A2 in complex with atropine at 1.23A resolution
Class: hydrolase
Keywords: Phospholipids, eicosanoids, inhibition, HYDROLASE
Deposited on 2004-06-01, released 2004-06-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.23 Å
R-factor: 0.189
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Daboia russellii russellii [TaxId:31159]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1th6a_
  • Heterogens: OIN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1th6A (A:)
    sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
    sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
    c