PDB entry 1th5

View 1th5 on RCSB PDB site
Description: Solution structure of C-terminal domain of NifU-like protein from Oryza sativa
Class: Structural genomics, unknown function
Keywords: IRON-SULFUR CLUSTER BINDING, STRUCTURAL GENOMICS, PROGRAM FOR RICE GENOME RESEARCH, unknown function
Deposited on 2004-06-01, released 2005-09-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NifU1
    Species: Oryza sativa [TaxId:4530]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84LK7 (1-73)
      • cloning artifact (0)
    Domains in SCOPe 2.08: d1th5a1, d1th5a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1th5A (A:)
    mlelneenvekvlneirpylagtgggglqflmikgpivkvrltgpaavvrtvriavskkl
    rekipsiqivqlls