PDB entry 1th4

View 1th4 on RCSB PDB site
Description: crystal structure of NADPH depleted bovine liver catalase complexed with 3-amino-1,2,4-triazole
Class: oxidoreductase
Keywords: bovine liver catalase, NADPH, 3-amino-1,2,4-triazole, oxidoreductase
Deposited on 2004-06-01, released 2005-07-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.98 Å
R-factor: 0.235
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: catalase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1th4a_
  • Chain 'B':
    Compound: catalase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1th4b_
  • Chain 'C':
    Compound: catalase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1th4c_
  • Chain 'D':
    Compound: catalase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1th4d_
  • Heterogens: 3TR, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1th4A (A:)
    adnrdpasdqmkhwkeqraaqkpdvlttgggnpvgdklnsltvgprgpllvqdvvftdem
    ahfdreripervvhakgagafgyfevthditryskakvfehigkrtpiavrfstvagesg
    sadtvrdprgfavkfytedgnwdlvgnntpiffirdallfpsfihsqkrnpqthlkdpdm
    vwdfwslrpeslhqvsflfsdrgipdghrhmdgygshtfklvnadgeavyckfhyktdqg
    iknlsvedaarlahedpdyglrdlfnaiatgnypswtlyiqvmtfseaeifpfnpfdltk
    vwphgdyplipvgklvlnrnpvnyfaeveqlafdpsnmppgiepspdkmlqgrlfaypdt
    hrhrlgpnylqipvncpyrarvanyqrdgpmcmmdnqggapnyypnsfsapehqpsaleh
    rthfsgdvqrfnsanddnvtqvrtfylkvlneeqrkrlceniaghlkdaqlfiqkkavkn
    fsdvhpeygsriqalldkyneekpkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1th4A (A:)
    nrdpasdqmkhwkeqraaqkpdvlttgggnpvgdklnsltvgprgpllvqdvvftdemah
    fdreripervvhakgagafgyfevthditryskakvfehigkrtpiavrfstvagesgsa
    dtvrdprgfavkfytedgnwdlvgnntpiffirdallfpsfihsqkrnpqthlkdpdmvw
    dfwslrpeslhqvsflfsdrgipdghrhmdgygshtfklvnadgeavyckfhyktdqgik
    nlsvedaarlahedpdyglrdlfnaiatgnypswtlyiqvmtfseaeifpfnpfdltkvw
    phgdyplipvgklvlnrnpvnyfaeveqlafdpsnmppgiepspdkmlqgrlfaypdthr
    hrlgpnylqipvncpyrarvanyqrdgpmcmmdnqggapnyypnsfsapehqpsalehrt
    hfsgdvqrfnsanddnvtqvrtfylkvlneeqrkrlceniaghlkdaqlfiqkkavknfs
    dvhpeygsriqalldkyne
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1th4B (B:)
    adnrdpasdqmkhwkeqraaqkpdvlttgggnpvgdklnsltvgprgpllvqdvvftdem
    ahfdreripervvhakgagafgyfevthditryskakvfehigkrtpiavrfstvagesg
    sadtvrdprgfavkfytedgnwdlvgnntpiffirdallfpsfihsqkrnpqthlkdpdm
    vwdfwslrpeslhqvsflfsdrgipdghrhmdgygshtfklvnadgeavyckfhyktdqg
    iknlsvedaarlahedpdyglrdlfnaiatgnypswtlyiqvmtfseaeifpfnpfdltk
    vwphgdyplipvgklvlnrnpvnyfaeveqlafdpsnmppgiepspdkmlqgrlfaypdt
    hrhrlgpnylqipvncpyrarvanyqrdgpmcmmdnqggapnyypnsfsapehqpsaleh
    rthfsgdvqrfnsanddnvtqvrtfylkvlneeqrkrlceniaghlkdaqlfiqkkavkn
    fsdvhpeygsriqalldkyneekpkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1th4B (B:)
    nrdpasdqmkhwkeqraaqkpdvlttgggnpvgdklnsltvgprgpllvqdvvftdemah
    fdreripervvhakgagafgyfevthditryskakvfehigkrtpiavrfstvagesgsa
    dtvrdprgfavkfytedgnwdlvgnntpiffirdallfpsfihsqkrnpqthlkdpdmvw
    dfwslrpeslhqvsflfsdrgipdghrhmdgygshtfklvnadgeavyckfhyktdqgik
    nlsvedaarlahedpdyglrdlfnaiatgnypswtlyiqvmtfseaeifpfnpfdltkvw
    phgdyplipvgklvlnrnpvnyfaeveqlafdpsnmppgiepspdkmlqgrlfaypdthr
    hrlgpnylqipvncpyrarvanyqrdgpmcmmdnqggapnyypnsfsapehqpsalehrt
    hfsgdvqrfnsanddnvtqvrtfylkvlneeqrkrlceniaghlkdaqlfiqkkavknfs
    dvhpeygsriqalldkyne
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1th4C (C:)
    adnrdpasdqmkhwkeqraaqkpdvlttgggnpvgdklnsltvgprgpllvqdvvftdem
    ahfdreripervvhakgagafgyfevthditryskakvfehigkrtpiavrfstvagesg
    sadtvrdprgfavkfytedgnwdlvgnntpiffirdallfpsfihsqkrnpqthlkdpdm
    vwdfwslrpeslhqvsflfsdrgipdghrhmdgygshtfklvnadgeavyckfhyktdqg
    iknlsvedaarlahedpdyglrdlfnaiatgnypswtlyiqvmtfseaeifpfnpfdltk
    vwphgdyplipvgklvlnrnpvnyfaeveqlafdpsnmppgiepspdkmlqgrlfaypdt
    hrhrlgpnylqipvncpyrarvanyqrdgpmcmmdnqggapnyypnsfsapehqpsaleh
    rthfsgdvqrfnsanddnvtqvrtfylkvlneeqrkrlceniaghlkdaqlfiqkkavkn
    fsdvhpeygsriqalldkyneekpkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1th4C (C:)
    nrdpasdqmkhwkeqraaqkpdvlttgggnpvgdklnsltvgprgpllvqdvvftdemah
    fdreripervvhakgagafgyfevthditryskakvfehigkrtpiavrfstvagesgsa
    dtvrdprgfavkfytedgnwdlvgnntpiffirdallfpsfihsqkrnpqthlkdpdmvw
    dfwslrpeslhqvsflfsdrgipdghrhmdgygshtfklvnadgeavyckfhyktdqgik
    nlsvedaarlahedpdyglrdlfnaiatgnypswtlyiqvmtfseaeifpfnpfdltkvw
    phgdyplipvgklvlnrnpvnyfaeveqlafdpsnmppgiepspdkmlqgrlfaypdthr
    hrlgpnylqipvncpyrarvanyqrdgpmcmmdnqggapnyypnsfsapehqpsalehrt
    hfsgdvqrfnsanddnvtqvrtfylkvlneeqrkrlceniaghlkdaqlfiqkkavknfs
    dvhpeygsriqalldkyne
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1th4D (D:)
    adnrdpasdqmkhwkeqraaqkpdvlttgggnpvgdklnsltvgprgpllvqdvvftdem
    ahfdreripervvhakgagafgyfevthditryskakvfehigkrtpiavrfstvagesg
    sadtvrdprgfavkfytedgnwdlvgnntpiffirdallfpsfihsqkrnpqthlkdpdm
    vwdfwslrpeslhqvsflfsdrgipdghrhmdgygshtfklvnadgeavyckfhyktdqg
    iknlsvedaarlahedpdyglrdlfnaiatgnypswtlyiqvmtfseaeifpfnpfdltk
    vwphgdyplipvgklvlnrnpvnyfaeveqlafdpsnmppgiepspdkmlqgrlfaypdt
    hrhrlgpnylqipvncpyrarvanyqrdgpmcmmdnqggapnyypnsfsapehqpsaleh
    rthfsgdvqrfnsanddnvtqvrtfylkvlneeqrkrlceniaghlkdaqlfiqkkavkn
    fsdvhpeygsriqalldkyneekpkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1th4D (D:)
    nrdpasdqmkhwkeqraaqkpdvlttgggnpvgdklnsltvgprgpllvqdvvftdemah
    fdreripervvhakgagafgyfevthditryskakvfehigkrtpiavrfstvagesgsa
    dtvrdprgfavkfytedgnwdlvgnntpiffirdallfpsfihsqkrnpqthlkdpdmvw
    dfwslrpeslhqvsflfsdrgipdghrhmdgygshtfklvnadgeavyckfhyktdqgik
    nlsvedaarlahedpdyglrdlfnaiatgnypswtlyiqvmtfseaeifpfnpfdltkvw
    phgdyplipvgklvlnrnpvnyfaeveqlafdpsnmppgiepspdkmlqgrlfaypdthr
    hrlgpnylqipvncpyrarvanyqrdgpmcmmdnqggapnyypnsfsapehqpsalehrt
    hfsgdvqrfnsanddnvtqvrtfylkvlneeqrkrlceniaghlkdaqlfiqkkavknfs
    dvhpeygsriqalldkyne