PDB entry 1th2

View 1th2 on RCSB PDB site
Description: crystal structure of NADPH depleted bovine liver catalase complexed with azide
Class: oxidoreductase
Keywords: NADPH, bovine liver catalase, azide, oxidoreductase
Deposited on 2004-06-01, released 2005-07-05
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.225
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: catalase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1th2a_
  • Chain 'B':
    Compound: catalase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1th2b_
  • Chain 'C':
    Compound: catalase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1th2c_
  • Chain 'D':
    Compound: catalase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1th2d_
  • Heterogens: AZI, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1th2A (A:)
    adnrdpasdqmkhwkeqraaqkpdvlttgggnpvgdklnsltvgprgpllvqdvvftdem
    ahfdreripervvhakgagafgyfevthditryskakvfehigkrtpiavrfstvagesg
    sadtvrdprgfavkfytedgnwdlvgnntpiffirdallfpsfihsqkrnpqthlkdpdm
    vwdfwslrpeslhqvsflfsdrgipdghrhmdgygshtfklvnadgeavyckfhyktdqg
    iknlsvedaarlahedpdyglrdlfnaiatgnypswtlyiqvmtfseaeifpfnpfdltk
    vwphgdyplipvgklvlnrnpvnyfaeveqlafdpsnmppgiepspdkmlqgrlfaypdt
    hrhrlgpnylqipvncpyrarvanyqrdgpmcmmdnqggapnyypnsfsapehqpsaleh
    rthfsgdvqrfnsanddnvtqvrtfylkvlneeqrkrlceniaghlkdaqlfiqkkavkn
    fsdvhpeygsriqalldkyneekpkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1th2A (A:)
    nrdpasdqmkhwkeqraaqkpdvlttgggnpvgdklnsltvgprgpllvqdvvftdemah
    fdreripervvhakgagafgyfevthditryskakvfehigkrtpiavrfstvagesgsa
    dtvrdprgfavkfytedgnwdlvgnntpiffirdallfpsfihsqkrnpqthlkdpdmvw
    dfwslrpeslhqvsflfsdrgipdghrhmdgygshtfklvnadgeavyckfhyktdqgik
    nlsvedaarlahedpdyglrdlfnaiatgnypswtlyiqvmtfseaeifpfnpfdltkvw
    phgdyplipvgklvlnrnpvnyfaeveqlafdpsnmppgiepspdkmlqgrlfaypdthr
    hrlgpnylqipvncpyrarvanyqrdgpmcmmdnqggapnyypnsfsapehqpsalehrt
    hfsgdvqrfnsanddnvtqvrtfylkvlneeqrkrlceniaghlkdaqlfiqkkavknfs
    dvhpeygsriqalldkyne
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1th2B (B:)
    adnrdpasdqmkhwkeqraaqkpdvlttgggnpvgdklnsltvgprgpllvqdvvftdem
    ahfdreripervvhakgagafgyfevthditryskakvfehigkrtpiavrfstvagesg
    sadtvrdprgfavkfytedgnwdlvgnntpiffirdallfpsfihsqkrnpqthlkdpdm
    vwdfwslrpeslhqvsflfsdrgipdghrhmdgygshtfklvnadgeavyckfhyktdqg
    iknlsvedaarlahedpdyglrdlfnaiatgnypswtlyiqvmtfseaeifpfnpfdltk
    vwphgdyplipvgklvlnrnpvnyfaeveqlafdpsnmppgiepspdkmlqgrlfaypdt
    hrhrlgpnylqipvncpyrarvanyqrdgpmcmmdnqggapnyypnsfsapehqpsaleh
    rthfsgdvqrfnsanddnvtqvrtfylkvlneeqrkrlceniaghlkdaqlfiqkkavkn
    fsdvhpeygsriqalldkyneekpkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1th2B (B:)
    nrdpasdqmkhwkeqraaqkpdvlttgggnpvgdklnsltvgprgpllvqdvvftdemah
    fdreripervvhakgagafgyfevthditryskakvfehigkrtpiavrfstvagesgsa
    dtvrdprgfavkfytedgnwdlvgnntpiffirdallfpsfihsqkrnpqthlkdpdmvw
    dfwslrpeslhqvsflfsdrgipdghrhmdgygshtfklvnadgeavyckfhyktdqgik
    nlsvedaarlahedpdyglrdlfnaiatgnypswtlyiqvmtfseaeifpfnpfdltkvw
    phgdyplipvgklvlnrnpvnyfaeveqlafdpsnmppgiepspdkmlqgrlfaypdthr
    hrlgpnylqipvncpyrarvanyqrdgpmcmmdnqggapnyypnsfsapehqpsalehrt
    hfsgdvqrfnsanddnvtqvrtfylkvlneeqrkrlceniaghlkdaqlfiqkkavknfs
    dvhpeygsriqalldkyne
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1th2C (C:)
    adnrdpasdqmkhwkeqraaqkpdvlttgggnpvgdklnsltvgprgpllvqdvvftdem
    ahfdreripervvhakgagafgyfevthditryskakvfehigkrtpiavrfstvagesg
    sadtvrdprgfavkfytedgnwdlvgnntpiffirdallfpsfihsqkrnpqthlkdpdm
    vwdfwslrpeslhqvsflfsdrgipdghrhmdgygshtfklvnadgeavyckfhyktdqg
    iknlsvedaarlahedpdyglrdlfnaiatgnypswtlyiqvmtfseaeifpfnpfdltk
    vwphgdyplipvgklvlnrnpvnyfaeveqlafdpsnmppgiepspdkmlqgrlfaypdt
    hrhrlgpnylqipvncpyrarvanyqrdgpmcmmdnqggapnyypnsfsapehqpsaleh
    rthfsgdvqrfnsanddnvtqvrtfylkvlneeqrkrlceniaghlkdaqlfiqkkavkn
    fsdvhpeygsriqalldkyneekpkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1th2C (C:)
    nrdpasdqmkhwkeqraaqkpdvlttgggnpvgdklnsltvgprgpllvqdvvftdemah
    fdreripervvhakgagafgyfevthditryskakvfehigkrtpiavrfstvagesgsa
    dtvrdprgfavkfytedgnwdlvgnntpiffirdallfpsfihsqkrnpqthlkdpdmvw
    dfwslrpeslhqvsflfsdrgipdghrhmdgygshtfklvnadgeavyckfhyktdqgik
    nlsvedaarlahedpdyglrdlfnaiatgnypswtlyiqvmtfseaeifpfnpfdltkvw
    phgdyplipvgklvlnrnpvnyfaeveqlafdpsnmppgiepspdkmlqgrlfaypdthr
    hrlgpnylqipvncpyrarvanyqrdgpmcmmdnqggapnyypnsfsapehqpsalehrt
    hfsgdvqrfnsanddnvtqvrtfylkvlneeqrkrlceniaghlkdaqlfiqkkavknfs
    dvhpeygsriqalldkyne
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1th2D (D:)
    adnrdpasdqmkhwkeqraaqkpdvlttgggnpvgdklnsltvgprgpllvqdvvftdem
    ahfdreripervvhakgagafgyfevthditryskakvfehigkrtpiavrfstvagesg
    sadtvrdprgfavkfytedgnwdlvgnntpiffirdallfpsfihsqkrnpqthlkdpdm
    vwdfwslrpeslhqvsflfsdrgipdghrhmdgygshtfklvnadgeavyckfhyktdqg
    iknlsvedaarlahedpdyglrdlfnaiatgnypswtlyiqvmtfseaeifpfnpfdltk
    vwphgdyplipvgklvlnrnpvnyfaeveqlafdpsnmppgiepspdkmlqgrlfaypdt
    hrhrlgpnylqipvncpyrarvanyqrdgpmcmmdnqggapnyypnsfsapehqpsaleh
    rthfsgdvqrfnsanddnvtqvrtfylkvlneeqrkrlceniaghlkdaqlfiqkkavkn
    fsdvhpeygsriqalldkyneekpkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1th2D (D:)
    nrdpasdqmkhwkeqraaqkpdvlttgggnpvgdklnsltvgprgpllvqdvvftdemah
    fdreripervvhakgagafgyfevthditryskakvfehigkrtpiavrfstvagesgsa
    dtvrdprgfavkfytedgnwdlvgnntpiffirdallfpsfihsqkrnpqthlkdpdmvw
    dfwslrpeslhqvsflfsdrgipdghrhmdgygshtfklvnadgeavyckfhyktdqgik
    nlsvedaarlahedpdyglrdlfnaiatgnypswtlyiqvmtfseaeifpfnpfdltkvw
    phgdyplipvgklvlnrnpvnyfaeveqlafdpsnmppgiepspdkmlqgrlfaypdthr
    hrlgpnylqipvncpyrarvanyqrdgpmcmmdnqggapnyypnsfsapehqpsalehrt
    hfsgdvqrfnsanddnvtqvrtfylkvlneeqrkrlceniaghlkdaqlfiqkkavknfs
    dvhpeygsriqalldkyne